Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3880065..3880717 | Replicon | chromosome |
Accession | NZ_CP122328 | ||
Organism | Pantoea agglomerans pv. betae strain 4188 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | A7P61_RS22530 | Protein ID | WP_064704967.1 |
Coordinates | 3880065..3880418 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A8X8DRN0 |
Locus tag | A7P61_RS22535 | Protein ID | WP_010252120.1 |
Coordinates | 3880418..3880717 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A7P61_RS22515 (A7P61_22515) | 3875791..3877575 | - | 1785 | WP_010252112.1 | GMC family oxidoreductase | - |
A7P61_RS22520 (A7P61_22520) | 3877578..3878312 | - | 735 | WP_033787533.1 | gluconate 2-dehydrogenase subunit 3 family protein | - |
A7P61_RS22525 (A7P61_22525) | 3878589..3879830 | + | 1242 | WP_010672044.1 | peptide antibiotic transporter SbmA | - |
A7P61_RS22530 (A7P61_22530) | 3880065..3880418 | + | 354 | WP_064704967.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
A7P61_RS22535 (A7P61_22535) | 3880418..3880717 | + | 300 | WP_010252120.1 | XRE family transcriptional regulator | Antitoxin |
A7P61_RS22540 (A7P61_22540) | 3880840..3881892 | - | 1053 | WP_064704968.1 | YncE family protein | - |
A7P61_RS22545 (A7P61_22545) | 3882090..3882305 | - | 216 | WP_064704969.1 | DUF1471 domain-containing protein | - |
A7P61_RS22550 (A7P61_22550) | 3882518..3883705 | - | 1188 | WP_064704970.1 | MFS transporter | - |
A7P61_RS22555 (A7P61_22555) | 3883810..3884775 | + | 966 | WP_064704971.1 | AraC family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13625.60 Da Isoelectric Point: 6.9525
>T276809 WP_064704967.1 NZ_CP122328:3880065-3880418 [Pantoea agglomerans pv. betae]
MWTVLLSPRFESWLSEQEEALQEKMLADPGKLKVYGPDLPRPYADTLKGSQYRNMKELCVQFSGKPFRAFYAFDPVRQAI
VLCAGDKSHDKRFYIRMIRIADDEFSAWLAEQEKGNN
MWTVLLSPRFESWLSEQEEALQEKMLADPGKLKVYGPDLPRPYADTLKGSQYRNMKELCVQFSGKPFRAFYAFDPVRQAI
VLCAGDKSHDKRFYIRMIRIADDEFSAWLAEQEKGNN
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|