Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1580005..1580665 | Replicon | chromosome |
Accession | NZ_CP122328 | ||
Organism | Pantoea agglomerans pv. betae strain 4188 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A349IFT5 |
Locus tag | A7P61_RS11540 | Protein ID | WP_010670918.1 |
Coordinates | 1580005..1580358 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | A7P61_RS11545 | Protein ID | WP_064703672.1 |
Coordinates | 1580363..1580665 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A7P61_RS11525 (A7P61_11525) | 1575585..1575984 | + | 400 | Protein_1421 | cell envelope integrity TolA C-terminal domain-containing protein | - |
A7P61_RS11530 (A7P61_11530) | 1576061..1578223 | - | 2163 | WP_074399975.1 | ferric-rhodotorulic acid/ferric-coprogen receptor FhuE | - |
A7P61_RS11535 (A7P61_11535) | 1578618..1579706 | + | 1089 | WP_064703788.1 | YncE family protein | - |
A7P61_RS11540 (A7P61_11540) | 1580005..1580358 | + | 354 | WP_010670918.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
A7P61_RS11545 (A7P61_11545) | 1580363..1580665 | + | 303 | WP_064703672.1 | XRE family transcriptional regulator | Antitoxin |
A7P61_RS11550 (A7P61_11550) | 1580873..1581769 | - | 897 | WP_064703671.1 | LysR family transcriptional regulator | - |
A7P61_RS11555 (A7P61_11555) | 1581912..1582778 | + | 867 | WP_064703670.1 | SDR family NAD(P)-dependent oxidoreductase | - |
A7P61_RS11560 (A7P61_11560) | 1582742..1583623 | + | 882 | WP_231115744.1 | SMP-30/gluconolactonase/LRE family protein | - |
A7P61_RS11570 (A7P61_11570) | 1584331..1585254 | + | 924 | WP_031591254.1 | sugar ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13649.71 Da Isoelectric Point: 8.4949
>T276805 WP_010670918.1 NZ_CP122328:1580005-1580358 [Pantoea agglomerans pv. betae]
VWMIKTTERFDRWFTLLNESDRACVLAALMVLREKGPGLSRPYADTLKGSVYINMKELRIQSRGDPIRAFFAFDPNRTAI
VLCAGNKVGNEKRFYQEMLPVADREFTHWLNSFKDEE
VWMIKTTERFDRWFTLLNESDRACVLAALMVLREKGPGLSRPYADTLKGSVYINMKELRIQSRGDPIRAFFAFDPNRTAI
VLCAGNKVGNEKRFYQEMLPVADREFTHWLNSFKDEE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|