Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
Location | 113232..113764 | Replicon | plasmid pPATHpab |
Accession | NZ_CP122327 | ||
Organism | Pantoea agglomerans pv. betae strain 4188 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | - |
Locus tag | A7P61_RS03945 | Protein ID | WP_064703620.1 |
Coordinates | 113489..113764 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | - |
Locus tag | A7P61_RS03940 | Protein ID | WP_064703619.1 |
Coordinates | 113232..113489 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A7P61_RS03920 (A7P61_03920) | 108383..109606 | + | 1224 | WP_283833883.1 | type III secretion system effector HopQ1-1 | - |
A7P61_RS03925 (A7P61_03925) | 109722..111839 | - | 2118 | WP_283833880.1 | type III secretion system effector HopD1 | - |
A7P61_RS03930 (A7P61_03930) | 112115..112216 | + | 102 | Protein_113 | IS6 family transposase | - |
A7P61_RS03935 (A7P61_03935) | 112200..112925 | + | 726 | WP_074399967.1 | DUF1173 family protein | - |
A7P61_RS03940 (A7P61_03940) | 113232..113489 | + | 258 | WP_064703619.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
A7P61_RS03945 (A7P61_03945) | 113489..113764 | + | 276 | WP_064703620.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
A7P61_RS03950 (A7P61_03950) | 113854..114086 | - | 233 | Protein_117 | transposase | - |
A7P61_RS03955 (A7P61_03955) | 114090..114206 | - | 117 | Protein_118 | transposase | - |
A7P61_RS03960 (A7P61_03960) | 114262..114776 | - | 515 | Protein_119 | helix-turn-helix domain-containing protein | - |
A7P61_RS03965 (A7P61_03965) | 115110..115352 | + | 243 | WP_064703622.1 | hypothetical protein | - |
A7P61_RS03970 (A7P61_03970) | 115381..116913 | - | 1533 | WP_064703623.1 | type III helper protein HopAK1 | - |
A7P61_RS03975 (A7P61_03975) | 117389..117606 | + | 218 | Protein_122 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | pla | 1..156057 | 156057 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10745.34 Da Isoelectric Point: 8.4536
>T276802 WP_064703620.1 NZ_CP122327:113489-113764 [Pantoea agglomerans pv. betae]
MLTPVQASAFKRDIKRQQKRGKDMTKLKTLIKLLVEEKEIPPEYEDHPLQGDWRGYRDAHMEGDWILIYKVEGTDLKLAR
TGTHQEIFSNY
MLTPVQASAFKRDIKRQQKRGKDMTKLKTLIKLLVEEKEIPPEYEDHPLQGDWRGYRDAHMEGDWILIYKVEGTDLKLAR
TGTHQEIFSNY
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|