Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3557268..3557928 | Replicon | chromosome |
Accession | NZ_CP122320 | ||
Organism | Pantoea agglomerans pv. gypsophilae strain 824-1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | A7P62_RS16950 | Protein ID | WP_033772148.1 |
Coordinates | 3557575..3557928 (-) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | A7P62_RS16945 | Protein ID | WP_010247918.1 |
Coordinates | 3557268..3557570 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A7P62_RS16925 (3553107) | 3553107..3554132 | - | 1026 | WP_174819610.1 | ABC transporter permease | - |
A7P62_RS16930 (3554156) | 3554156..3555640 | - | 1485 | WP_010247905.1 | sugar ABC transporter ATP-binding protein | - |
A7P62_RS16935 (3555673) | 3555673..3556596 | - | 924 | WP_010247907.1 | sugar ABC transporter substrate-binding protein | - |
A7P62_RS16945 (3557268) | 3557268..3557570 | - | 303 | WP_010247918.1 | XRE family transcriptional regulator | Antitoxin |
A7P62_RS16950 (3557575) | 3557575..3557928 | - | 354 | WP_033772148.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
A7P62_RS16955 (3558227) | 3558227..3559315 | - | 1089 | WP_029519619.1 | YncE family protein | - |
A7P62_RS16960 (3559711) | 3559711..3561873 | + | 2163 | WP_074399302.1 | ferric-rhodotorulic acid/ferric-coprogen receptor FhuE | - |
A7P62_RS16965 (3561950) | 3561950..3562351 | - | 402 | WP_064690186.1 | cell envelope integrity TolA C-terminal domain-containing protein | - |
A7P62_RS16970 (3562450) | 3562450..3562731 | - | 282 | WP_010247933.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13681.77 Da Isoelectric Point: 8.4949
>T276790 WP_033772148.1 NZ_CP122320:c3557928-3557575 [Pantoea agglomerans pv. gypsophilae]
VWMIKTTERFDRWFTLLNESDRACVLAALMVLREKGPGLSRPYADTLKGSVYINMKELRIQSRGDPIRAFFAFDPNRTAI
VLCAGNKMGNEKRFYQEMLPVADREFTHWLNSFKDEE
VWMIKTTERFDRWFTLLNESDRACVLAALMVLREKGPGLSRPYADTLKGSVYINMKELRIQSRGDPIRAFFAFDPNRTAI
VLCAGNKMGNEKRFYQEMLPVADREFTHWLNSFKDEE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|