Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3371511..3372241 | Replicon | chromosome |
| Accession | NZ_CP122320 | ||
| Organism | Pantoea agglomerans pv. gypsophilae strain 824-1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A356RQP5 |
| Locus tag | A7P62_RS16090 | Protein ID | WP_010670815.1 |
| Coordinates | 3371511..3371828 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | A7P62_RS16095 | Protein ID | WP_039391120.1 |
| Coordinates | 3371909..3372241 (+) | Length | 111 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A7P62_RS16070 (3367143) | 3367143..3367265 | + | 123 | WP_009089698.1 | hypothetical protein | - |
| A7P62_RS16075 (3367476) | 3367476..3369206 | + | 1731 | WP_064691407.1 | arginine--tRNA ligase | - |
| A7P62_RS16080 (3369293) | 3369293..3370228 | + | 936 | WP_064691408.1 | LysR family transcriptional regulator | - |
| A7P62_RS16085 (3370438) | 3370438..3371436 | + | 999 | WP_064691409.1 | aldo/keto reductase | - |
| A7P62_RS16090 (3371511) | 3371511..3371828 | + | 318 | WP_010670815.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| A7P62_RS16095 (3371909) | 3371909..3372241 | + | 333 | WP_039391120.1 | HigA family addiction module antitoxin | Antitoxin |
| A7P62_RS16100 (3372404) | 3372404..3372796 | - | 393 | WP_045139882.1 | flagellar protein FlhE | - |
| A7P62_RS16105 (3372796) | 3372796..3374889 | - | 2094 | WP_010258569.1 | flagellar biosynthesis protein FlhA | - |
| A7P62_RS16110 (3374882) | 3374882..3376033 | - | 1152 | WP_033772015.1 | flagellar biosynthesis protein FlhB | - |
| A7P62_RS16115 (3376222) | 3376222..3376863 | - | 642 | WP_003849160.1 | protein phosphatase CheZ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12284.10 Da Isoelectric Point: 10.1171
>T276789 WP_010670815.1 NZ_CP122320:3371511-3371828 [Pantoea agglomerans pv. gypsophilae]
VATLRNIESFRDDWLKDYFLYGKFSKRIPSSLSSALARKLDIINAAISYKDLKSPPGNRYEELNPPLKGYASIRVNEQYR
LIFKWIEGKAVDLYLDAHSYKTHKR
VATLRNIESFRDDWLKDYFLYGKFSKRIPSSLSSALARKLDIINAAISYKDLKSPPGNRYEELNPPLKGYASIRVNEQYR
LIFKWIEGKAVDLYLDAHSYKTHKR
Download Length: 318 bp
Antitoxin
Download Length: 111 a.a. Molecular weight: 12587.43 Da Isoelectric Point: 5.1473
>AT276789 WP_039391120.1 NZ_CP122320:3371909-3372241 [Pantoea agglomerans pv. gypsophilae]
MNQATRKPTTVGDVLLYEYLEPTGLKILDLAEMLKVHRNTVSALVNNNRKLTPDMAFRLAAAFETSVEFWLNLQNSVDIW
EVMHDARAQEEISRVTPLKDFLAQKENQLA
MNQATRKPTTVGDVLLYEYLEPTGLKILDLAEMLKVHRNTVSALVNNNRKLTPDMAFRLAAAFETSVEFWLNLQNSVDIW
EVMHDARAQEEISRVTPLKDFLAQKENQLA
Download Length: 333 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|