Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 2230992..2231596 | Replicon | chromosome |
| Accession | NZ_CP122320 | ||
| Organism | Pantoea agglomerans pv. gypsophilae strain 824-1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | A7P62_RS10585 | Protein ID | WP_010669712.1 |
| Coordinates | 2231285..2231596 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | A7P62_RS10580 | Protein ID | WP_010669711.1 |
| Coordinates | 2230992..2231285 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A7P62_RS10560 (2226413) | 2226413..2226640 | + | 228 | WP_010254235.1 | hypothetical protein | - |
| A7P62_RS10565 (2226970) | 2226970..2228079 | + | 1110 | WP_033779531.1 | suppressor of fused domain protein | - |
| A7P62_RS10570 (2228271) | 2228271..2230166 | + | 1896 | WP_022625996.1 | methyl-accepting chemotaxis protein | - |
| A7P62_RS10575 (2230313) | 2230313..2230855 | + | 543 | WP_064690047.1 | isopentenyl-diphosphate Delta-isomerase | - |
| A7P62_RS10580 (2230992) | 2230992..2231285 | - | 294 | WP_010669711.1 | NadS family protein | Antitoxin |
| A7P62_RS10585 (2231285) | 2231285..2231596 | - | 312 | WP_010669712.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| A7P62_RS10590 (2231775) | 2231775..2233250 | - | 1476 | WP_033785500.1 | MFS transporter | - |
| A7P62_RS10595 (2233557) | 2233557..2234468 | + | 912 | WP_064690048.1 | ABC transporter substrate-binding protein | - |
| A7P62_RS10600 (2234472) | 2234472..2235647 | + | 1176 | WP_064690049.1 | ABC transporter permease | - |
| A7P62_RS10605 (2235640) | 2235640..2236587 | + | 948 | WP_010254263.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11997.67 Da Isoelectric Point: 5.8988
>T276787 WP_010669712.1 NZ_CP122320:c2231596-2231285 [Pantoea agglomerans pv. gypsophilae]
MLFIETPVFTEDVKELLSDDEYREFQQFMADNPGWGDVIQNTGGLRKVRWAAKGKGKRGGVRVIYYYKVSESQIRLLLIY
KKGVQDDLSEDEKHLLRALNEGW
MLFIETPVFTEDVKELLSDDEYREFQQFMADNPGWGDVIQNTGGLRKVRWAAKGKGKRGGVRVIYYYKVSESQIRLLLIY
KKGVQDDLSEDEKHLLRALNEGW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|