Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1329499..1330144 | Replicon | chromosome |
Accession | NZ_CP122320 | ||
Organism | Pantoea agglomerans pv. gypsophilae strain 824-1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | A7P62_RS06310 | Protein ID | WP_064690603.1 |
Coordinates | 1329499..1329852 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | A7P62_RS06315 | Protein ID | WP_064690602.1 |
Coordinates | 1329845..1330144 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A7P62_RS06290 (1325355) | 1325355..1326320 | - | 966 | WP_033770846.1 | AraC family transcriptional regulator | - |
A7P62_RS06295 (1326425) | 1326425..1327612 | + | 1188 | WP_064690604.1 | MFS transporter | - |
A7P62_RS06300 (1327825) | 1327825..1328034 | + | 210 | WP_009092571.1 | DUF1471 domain-containing protein | - |
A7P62_RS06305 (1328237) | 1328237..1329289 | + | 1053 | WP_010672046.1 | YncE family protein | - |
A7P62_RS06310 (1329499) | 1329499..1329852 | + | 354 | WP_064690603.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
A7P62_RS06315 (1329845) | 1329845..1330144 | + | 300 | WP_064690602.1 | helix-turn-helix transcriptional regulator | Antitoxin |
A7P62_RS06320 (1330192) | 1330192..1331436 | - | 1245 | WP_010252115.1 | peptide antibiotic transporter SbmA | - |
A7P62_RS06325 (1331713) | 1331713..1332447 | + | 735 | WP_010672043.1 | gluconate 2-dehydrogenase subunit 3 family protein | - |
A7P62_RS06330 (1332450) | 1332450..1334234 | + | 1785 | WP_064690601.1 | GMC family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1320095..1330144 | 10049 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13429.33 Da Isoelectric Point: 7.2774
>T276784 WP_064690603.1 NZ_CP122320:1329499-1329852 [Pantoea agglomerans pv. gypsophilae]
MWDVDTTKRFDEWFKAQSEELKEDMLAAIVILSEYGPHLARPFADTVDGSHFPNMKELRVQHQGKPIRAFFAFDPSRRGI
VLCAGDKTGVKEKKFYKDMIKLADAEFRKYLNGGDNG
MWDVDTTKRFDEWFKAQSEELKEDMLAAIVILSEYGPHLARPFADTVDGSHFPNMKELRVQHQGKPIRAFFAFDPSRRGI
VLCAGDKTGVKEKKFYKDMIKLADAEFRKYLNGGDNG
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|