Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 3706753..3706975 | Replicon | chromosome |
Accession | NZ_CP122319 | ||
Organism | Escherichia coli strain BW25113 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | J7R083 |
Locus tag | QCG47_RS17940 | Protein ID | WP_000170963.1 |
Coordinates | 3706753..3706860 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 3706908..3706975 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG47_RS17910 (3702062) | 3702062..3703144 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
QCG47_RS17915 (3703144) | 3703144..3703977 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
QCG47_RS17920 (3703974) | 3703974..3704366 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
QCG47_RS17925 (3704370) | 3704370..3705179 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
QCG47_RS17930 (3705215) | 3705215..3706069 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
QCG47_RS17935 (3706218) | 3706218..3706325 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (3706373) | 3706373..3706439 | + | 67 | NuclAT_34 | - | - |
- (3706373) | 3706373..3706439 | + | 67 | NuclAT_34 | - | - |
- (3706373) | 3706373..3706439 | + | 67 | NuclAT_34 | - | - |
- (3706373) | 3706373..3706439 | + | 67 | NuclAT_34 | - | - |
- (3706373) | 3706373..3706439 | + | 67 | NuclAT_36 | - | - |
- (3706373) | 3706373..3706439 | + | 67 | NuclAT_36 | - | - |
- (3706373) | 3706373..3706439 | + | 67 | NuclAT_36 | - | - |
- (3706373) | 3706373..3706439 | + | 67 | NuclAT_36 | - | - |
- (3706373) | 3706373..3706439 | + | 67 | NuclAT_38 | - | - |
- (3706373) | 3706373..3706439 | + | 67 | NuclAT_38 | - | - |
- (3706373) | 3706373..3706439 | + | 67 | NuclAT_38 | - | - |
- (3706373) | 3706373..3706439 | + | 67 | NuclAT_38 | - | - |
- (3706373) | 3706373..3706439 | + | 67 | NuclAT_40 | - | - |
- (3706373) | 3706373..3706439 | + | 67 | NuclAT_40 | - | - |
- (3706373) | 3706373..3706439 | + | 67 | NuclAT_40 | - | - |
- (3706373) | 3706373..3706439 | + | 67 | NuclAT_40 | - | - |
- (3706373) | 3706373..3706439 | + | 67 | NuclAT_42 | - | - |
- (3706373) | 3706373..3706439 | + | 67 | NuclAT_42 | - | - |
- (3706373) | 3706373..3706439 | + | 67 | NuclAT_42 | - | - |
- (3706373) | 3706373..3706439 | + | 67 | NuclAT_42 | - | - |
- (3706373) | 3706373..3706439 | + | 67 | NuclAT_44 | - | - |
- (3706373) | 3706373..3706439 | + | 67 | NuclAT_44 | - | - |
- (3706373) | 3706373..3706439 | + | 67 | NuclAT_44 | - | - |
- (3706373) | 3706373..3706439 | + | 67 | NuclAT_44 | - | - |
- (3706375) | 3706375..3706440 | + | 66 | NuclAT_18 | - | - |
- (3706375) | 3706375..3706440 | + | 66 | NuclAT_18 | - | - |
- (3706375) | 3706375..3706440 | + | 66 | NuclAT_18 | - | - |
- (3706375) | 3706375..3706440 | + | 66 | NuclAT_18 | - | - |
- (3706375) | 3706375..3706440 | + | 66 | NuclAT_21 | - | - |
- (3706375) | 3706375..3706440 | + | 66 | NuclAT_21 | - | - |
- (3706375) | 3706375..3706440 | + | 66 | NuclAT_21 | - | - |
- (3706375) | 3706375..3706440 | + | 66 | NuclAT_21 | - | - |
- (3706375) | 3706375..3706440 | + | 66 | NuclAT_24 | - | - |
- (3706375) | 3706375..3706440 | + | 66 | NuclAT_24 | - | - |
- (3706375) | 3706375..3706440 | + | 66 | NuclAT_24 | - | - |
- (3706375) | 3706375..3706440 | + | 66 | NuclAT_24 | - | - |
- (3706375) | 3706375..3706440 | + | 66 | NuclAT_27 | - | - |
- (3706375) | 3706375..3706440 | + | 66 | NuclAT_27 | - | - |
- (3706375) | 3706375..3706440 | + | 66 | NuclAT_27 | - | - |
- (3706375) | 3706375..3706440 | + | 66 | NuclAT_27 | - | - |
- (3706375) | 3706375..3706440 | + | 66 | NuclAT_30 | - | - |
- (3706375) | 3706375..3706440 | + | 66 | NuclAT_30 | - | - |
- (3706375) | 3706375..3706440 | + | 66 | NuclAT_30 | - | - |
- (3706375) | 3706375..3706440 | + | 66 | NuclAT_30 | - | - |
- (3706375) | 3706375..3706440 | + | 66 | NuclAT_33 | - | - |
- (3706375) | 3706375..3706440 | + | 66 | NuclAT_33 | - | - |
- (3706375) | 3706375..3706440 | + | 66 | NuclAT_33 | - | - |
- (3706375) | 3706375..3706440 | + | 66 | NuclAT_33 | - | - |
QCG47_RS17940 (3706753) | 3706753..3706860 | - | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (3706909) | 3706909..3706974 | + | 66 | NuclAT_35 | - | - |
- (3706909) | 3706909..3706974 | + | 66 | NuclAT_35 | - | - |
- (3706909) | 3706909..3706974 | + | 66 | NuclAT_35 | - | - |
- (3706909) | 3706909..3706974 | + | 66 | NuclAT_35 | - | - |
- (3706909) | 3706909..3706974 | + | 66 | NuclAT_37 | - | - |
- (3706909) | 3706909..3706974 | + | 66 | NuclAT_37 | - | - |
- (3706909) | 3706909..3706974 | + | 66 | NuclAT_37 | - | - |
- (3706909) | 3706909..3706974 | + | 66 | NuclAT_37 | - | - |
- (3706909) | 3706909..3706974 | + | 66 | NuclAT_39 | - | - |
- (3706909) | 3706909..3706974 | + | 66 | NuclAT_39 | - | - |
- (3706909) | 3706909..3706974 | + | 66 | NuclAT_39 | - | - |
- (3706909) | 3706909..3706974 | + | 66 | NuclAT_39 | - | - |
- (3706909) | 3706909..3706974 | + | 66 | NuclAT_41 | - | - |
- (3706909) | 3706909..3706974 | + | 66 | NuclAT_41 | - | - |
- (3706909) | 3706909..3706974 | + | 66 | NuclAT_41 | - | - |
- (3706909) | 3706909..3706974 | + | 66 | NuclAT_41 | - | - |
- (3706909) | 3706909..3706974 | + | 66 | NuclAT_43 | - | - |
- (3706909) | 3706909..3706974 | + | 66 | NuclAT_43 | - | - |
- (3706909) | 3706909..3706974 | + | 66 | NuclAT_43 | - | - |
- (3706909) | 3706909..3706974 | + | 66 | NuclAT_43 | - | - |
- (3706909) | 3706909..3706974 | + | 66 | NuclAT_45 | - | - |
- (3706909) | 3706909..3706974 | + | 66 | NuclAT_45 | - | - |
- (3706909) | 3706909..3706974 | + | 66 | NuclAT_45 | - | - |
- (3706909) | 3706909..3706974 | + | 66 | NuclAT_45 | - | - |
- (3706908) | 3706908..3706975 | + | 68 | NuclAT_17 | - | Antitoxin |
- (3706908) | 3706908..3706975 | + | 68 | NuclAT_17 | - | Antitoxin |
- (3706908) | 3706908..3706975 | + | 68 | NuclAT_17 | - | Antitoxin |
- (3706908) | 3706908..3706975 | + | 68 | NuclAT_17 | - | Antitoxin |
- (3706908) | 3706908..3706975 | + | 68 | NuclAT_20 | - | Antitoxin |
- (3706908) | 3706908..3706975 | + | 68 | NuclAT_20 | - | Antitoxin |
- (3706908) | 3706908..3706975 | + | 68 | NuclAT_20 | - | Antitoxin |
- (3706908) | 3706908..3706975 | + | 68 | NuclAT_20 | - | Antitoxin |
- (3706908) | 3706908..3706975 | + | 68 | NuclAT_23 | - | Antitoxin |
- (3706908) | 3706908..3706975 | + | 68 | NuclAT_23 | - | Antitoxin |
- (3706908) | 3706908..3706975 | + | 68 | NuclAT_23 | - | Antitoxin |
- (3706908) | 3706908..3706975 | + | 68 | NuclAT_23 | - | Antitoxin |
- (3706908) | 3706908..3706975 | + | 68 | NuclAT_26 | - | Antitoxin |
- (3706908) | 3706908..3706975 | + | 68 | NuclAT_26 | - | Antitoxin |
- (3706908) | 3706908..3706975 | + | 68 | NuclAT_26 | - | Antitoxin |
- (3706908) | 3706908..3706975 | + | 68 | NuclAT_26 | - | Antitoxin |
- (3706908) | 3706908..3706975 | + | 68 | NuclAT_29 | - | Antitoxin |
- (3706908) | 3706908..3706975 | + | 68 | NuclAT_29 | - | Antitoxin |
- (3706908) | 3706908..3706975 | + | 68 | NuclAT_29 | - | Antitoxin |
- (3706908) | 3706908..3706975 | + | 68 | NuclAT_29 | - | Antitoxin |
- (3706908) | 3706908..3706975 | + | 68 | NuclAT_32 | - | Antitoxin |
- (3706908) | 3706908..3706975 | + | 68 | NuclAT_32 | - | Antitoxin |
- (3706908) | 3706908..3706975 | + | 68 | NuclAT_32 | - | Antitoxin |
- (3706908) | 3706908..3706975 | + | 68 | NuclAT_32 | - | Antitoxin |
QCG47_RS17945 (3707288) | 3707288..3707395 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (3707443) | 3707443..3707510 | + | 68 | NuclAT_16 | - | - |
- (3707443) | 3707443..3707510 | + | 68 | NuclAT_16 | - | - |
- (3707443) | 3707443..3707510 | + | 68 | NuclAT_16 | - | - |
- (3707443) | 3707443..3707510 | + | 68 | NuclAT_16 | - | - |
- (3707443) | 3707443..3707510 | + | 68 | NuclAT_19 | - | - |
- (3707443) | 3707443..3707510 | + | 68 | NuclAT_19 | - | - |
- (3707443) | 3707443..3707510 | + | 68 | NuclAT_19 | - | - |
- (3707443) | 3707443..3707510 | + | 68 | NuclAT_19 | - | - |
- (3707443) | 3707443..3707510 | + | 68 | NuclAT_22 | - | - |
- (3707443) | 3707443..3707510 | + | 68 | NuclAT_22 | - | - |
- (3707443) | 3707443..3707510 | + | 68 | NuclAT_22 | - | - |
- (3707443) | 3707443..3707510 | + | 68 | NuclAT_22 | - | - |
- (3707443) | 3707443..3707510 | + | 68 | NuclAT_25 | - | - |
- (3707443) | 3707443..3707510 | + | 68 | NuclAT_25 | - | - |
- (3707443) | 3707443..3707510 | + | 68 | NuclAT_25 | - | - |
- (3707443) | 3707443..3707510 | + | 68 | NuclAT_25 | - | - |
- (3707443) | 3707443..3707510 | + | 68 | NuclAT_28 | - | - |
- (3707443) | 3707443..3707510 | + | 68 | NuclAT_28 | - | - |
- (3707443) | 3707443..3707510 | + | 68 | NuclAT_28 | - | - |
- (3707443) | 3707443..3707510 | + | 68 | NuclAT_28 | - | - |
- (3707443) | 3707443..3707510 | + | 68 | NuclAT_31 | - | - |
- (3707443) | 3707443..3707510 | + | 68 | NuclAT_31 | - | - |
- (3707443) | 3707443..3707510 | + | 68 | NuclAT_31 | - | - |
- (3707443) | 3707443..3707510 | + | 68 | NuclAT_31 | - | - |
QCG47_RS17950 (3707799) | 3707799..3708899 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
QCG47_RS17955 (3709169) | 3709169..3709399 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
QCG47_RS17960 (3709557) | 3709557..3710252 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
QCG47_RS17965 (3710296) | 3710296..3710649 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T276766 WP_000170963.1 NZ_CP122319:c3706860-3706753 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 68 bp
>AT276766 NZ_CP122319:3706908-3706975 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|