Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 3706753..3706975 Replicon chromosome
Accession NZ_CP122319
Organism Escherichia coli strain BW25113

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag QCG47_RS17940 Protein ID WP_000170963.1
Coordinates 3706753..3706860 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 3706908..3706975 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QCG47_RS17910 (3702062) 3702062..3703144 + 1083 WP_000804726.1 peptide chain release factor 1 -
QCG47_RS17915 (3703144) 3703144..3703977 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
QCG47_RS17920 (3703974) 3703974..3704366 + 393 WP_000200374.1 invasion regulator SirB2 -
QCG47_RS17925 (3704370) 3704370..3705179 + 810 WP_001257044.1 invasion regulator SirB1 -
QCG47_RS17930 (3705215) 3705215..3706069 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QCG47_RS17935 (3706218) 3706218..3706325 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (3706373) 3706373..3706439 + 67 NuclAT_34 - -
- (3706373) 3706373..3706439 + 67 NuclAT_34 - -
- (3706373) 3706373..3706439 + 67 NuclAT_34 - -
- (3706373) 3706373..3706439 + 67 NuclAT_34 - -
- (3706373) 3706373..3706439 + 67 NuclAT_36 - -
- (3706373) 3706373..3706439 + 67 NuclAT_36 - -
- (3706373) 3706373..3706439 + 67 NuclAT_36 - -
- (3706373) 3706373..3706439 + 67 NuclAT_36 - -
- (3706373) 3706373..3706439 + 67 NuclAT_38 - -
- (3706373) 3706373..3706439 + 67 NuclAT_38 - -
- (3706373) 3706373..3706439 + 67 NuclAT_38 - -
- (3706373) 3706373..3706439 + 67 NuclAT_38 - -
- (3706373) 3706373..3706439 + 67 NuclAT_40 - -
- (3706373) 3706373..3706439 + 67 NuclAT_40 - -
- (3706373) 3706373..3706439 + 67 NuclAT_40 - -
- (3706373) 3706373..3706439 + 67 NuclAT_40 - -
- (3706373) 3706373..3706439 + 67 NuclAT_42 - -
- (3706373) 3706373..3706439 + 67 NuclAT_42 - -
- (3706373) 3706373..3706439 + 67 NuclAT_42 - -
- (3706373) 3706373..3706439 + 67 NuclAT_42 - -
- (3706373) 3706373..3706439 + 67 NuclAT_44 - -
- (3706373) 3706373..3706439 + 67 NuclAT_44 - -
- (3706373) 3706373..3706439 + 67 NuclAT_44 - -
- (3706373) 3706373..3706439 + 67 NuclAT_44 - -
- (3706375) 3706375..3706440 + 66 NuclAT_18 - -
- (3706375) 3706375..3706440 + 66 NuclAT_18 - -
- (3706375) 3706375..3706440 + 66 NuclAT_18 - -
- (3706375) 3706375..3706440 + 66 NuclAT_18 - -
- (3706375) 3706375..3706440 + 66 NuclAT_21 - -
- (3706375) 3706375..3706440 + 66 NuclAT_21 - -
- (3706375) 3706375..3706440 + 66 NuclAT_21 - -
- (3706375) 3706375..3706440 + 66 NuclAT_21 - -
- (3706375) 3706375..3706440 + 66 NuclAT_24 - -
- (3706375) 3706375..3706440 + 66 NuclAT_24 - -
- (3706375) 3706375..3706440 + 66 NuclAT_24 - -
- (3706375) 3706375..3706440 + 66 NuclAT_24 - -
- (3706375) 3706375..3706440 + 66 NuclAT_27 - -
- (3706375) 3706375..3706440 + 66 NuclAT_27 - -
- (3706375) 3706375..3706440 + 66 NuclAT_27 - -
- (3706375) 3706375..3706440 + 66 NuclAT_27 - -
- (3706375) 3706375..3706440 + 66 NuclAT_30 - -
- (3706375) 3706375..3706440 + 66 NuclAT_30 - -
- (3706375) 3706375..3706440 + 66 NuclAT_30 - -
- (3706375) 3706375..3706440 + 66 NuclAT_30 - -
- (3706375) 3706375..3706440 + 66 NuclAT_33 - -
- (3706375) 3706375..3706440 + 66 NuclAT_33 - -
- (3706375) 3706375..3706440 + 66 NuclAT_33 - -
- (3706375) 3706375..3706440 + 66 NuclAT_33 - -
QCG47_RS17940 (3706753) 3706753..3706860 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (3706909) 3706909..3706974 + 66 NuclAT_35 - -
- (3706909) 3706909..3706974 + 66 NuclAT_35 - -
- (3706909) 3706909..3706974 + 66 NuclAT_35 - -
- (3706909) 3706909..3706974 + 66 NuclAT_35 - -
- (3706909) 3706909..3706974 + 66 NuclAT_37 - -
- (3706909) 3706909..3706974 + 66 NuclAT_37 - -
- (3706909) 3706909..3706974 + 66 NuclAT_37 - -
- (3706909) 3706909..3706974 + 66 NuclAT_37 - -
- (3706909) 3706909..3706974 + 66 NuclAT_39 - -
- (3706909) 3706909..3706974 + 66 NuclAT_39 - -
- (3706909) 3706909..3706974 + 66 NuclAT_39 - -
- (3706909) 3706909..3706974 + 66 NuclAT_39 - -
- (3706909) 3706909..3706974 + 66 NuclAT_41 - -
- (3706909) 3706909..3706974 + 66 NuclAT_41 - -
- (3706909) 3706909..3706974 + 66 NuclAT_41 - -
- (3706909) 3706909..3706974 + 66 NuclAT_41 - -
- (3706909) 3706909..3706974 + 66 NuclAT_43 - -
- (3706909) 3706909..3706974 + 66 NuclAT_43 - -
- (3706909) 3706909..3706974 + 66 NuclAT_43 - -
- (3706909) 3706909..3706974 + 66 NuclAT_43 - -
- (3706909) 3706909..3706974 + 66 NuclAT_45 - -
- (3706909) 3706909..3706974 + 66 NuclAT_45 - -
- (3706909) 3706909..3706974 + 66 NuclAT_45 - -
- (3706909) 3706909..3706974 + 66 NuclAT_45 - -
- (3706908) 3706908..3706975 + 68 NuclAT_17 - Antitoxin
- (3706908) 3706908..3706975 + 68 NuclAT_17 - Antitoxin
- (3706908) 3706908..3706975 + 68 NuclAT_17 - Antitoxin
- (3706908) 3706908..3706975 + 68 NuclAT_17 - Antitoxin
- (3706908) 3706908..3706975 + 68 NuclAT_20 - Antitoxin
- (3706908) 3706908..3706975 + 68 NuclAT_20 - Antitoxin
- (3706908) 3706908..3706975 + 68 NuclAT_20 - Antitoxin
- (3706908) 3706908..3706975 + 68 NuclAT_20 - Antitoxin
- (3706908) 3706908..3706975 + 68 NuclAT_23 - Antitoxin
- (3706908) 3706908..3706975 + 68 NuclAT_23 - Antitoxin
- (3706908) 3706908..3706975 + 68 NuclAT_23 - Antitoxin
- (3706908) 3706908..3706975 + 68 NuclAT_23 - Antitoxin
- (3706908) 3706908..3706975 + 68 NuclAT_26 - Antitoxin
- (3706908) 3706908..3706975 + 68 NuclAT_26 - Antitoxin
- (3706908) 3706908..3706975 + 68 NuclAT_26 - Antitoxin
- (3706908) 3706908..3706975 + 68 NuclAT_26 - Antitoxin
- (3706908) 3706908..3706975 + 68 NuclAT_29 - Antitoxin
- (3706908) 3706908..3706975 + 68 NuclAT_29 - Antitoxin
- (3706908) 3706908..3706975 + 68 NuclAT_29 - Antitoxin
- (3706908) 3706908..3706975 + 68 NuclAT_29 - Antitoxin
- (3706908) 3706908..3706975 + 68 NuclAT_32 - Antitoxin
- (3706908) 3706908..3706975 + 68 NuclAT_32 - Antitoxin
- (3706908) 3706908..3706975 + 68 NuclAT_32 - Antitoxin
- (3706908) 3706908..3706975 + 68 NuclAT_32 - Antitoxin
QCG47_RS17945 (3707288) 3707288..3707395 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (3707443) 3707443..3707510 + 68 NuclAT_16 - -
- (3707443) 3707443..3707510 + 68 NuclAT_16 - -
- (3707443) 3707443..3707510 + 68 NuclAT_16 - -
- (3707443) 3707443..3707510 + 68 NuclAT_16 - -
- (3707443) 3707443..3707510 + 68 NuclAT_19 - -
- (3707443) 3707443..3707510 + 68 NuclAT_19 - -
- (3707443) 3707443..3707510 + 68 NuclAT_19 - -
- (3707443) 3707443..3707510 + 68 NuclAT_19 - -
- (3707443) 3707443..3707510 + 68 NuclAT_22 - -
- (3707443) 3707443..3707510 + 68 NuclAT_22 - -
- (3707443) 3707443..3707510 + 68 NuclAT_22 - -
- (3707443) 3707443..3707510 + 68 NuclAT_22 - -
- (3707443) 3707443..3707510 + 68 NuclAT_25 - -
- (3707443) 3707443..3707510 + 68 NuclAT_25 - -
- (3707443) 3707443..3707510 + 68 NuclAT_25 - -
- (3707443) 3707443..3707510 + 68 NuclAT_25 - -
- (3707443) 3707443..3707510 + 68 NuclAT_28 - -
- (3707443) 3707443..3707510 + 68 NuclAT_28 - -
- (3707443) 3707443..3707510 + 68 NuclAT_28 - -
- (3707443) 3707443..3707510 + 68 NuclAT_28 - -
- (3707443) 3707443..3707510 + 68 NuclAT_31 - -
- (3707443) 3707443..3707510 + 68 NuclAT_31 - -
- (3707443) 3707443..3707510 + 68 NuclAT_31 - -
- (3707443) 3707443..3707510 + 68 NuclAT_31 - -
QCG47_RS17950 (3707799) 3707799..3708899 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
QCG47_RS17955 (3709169) 3709169..3709399 + 231 WP_001146444.1 putative cation transport regulator ChaB -
QCG47_RS17960 (3709557) 3709557..3710252 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
QCG47_RS17965 (3710296) 3710296..3710649 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T276766 WP_000170963.1 NZ_CP122319:c3706860-3706753 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 68 bp

>AT276766 NZ_CP122319:3706908-3706975 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References