Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 2689539..2690233 | Replicon | chromosome |
| Accession | NZ_CP122319 | ||
| Organism | Escherichia coli strain BW25113 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | QCG47_RS12850 | Protein ID | WP_001263489.1 |
| Coordinates | 2689835..2690233 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | QCG47_RS12845 | Protein ID | WP_000554758.1 |
| Coordinates | 2689539..2689832 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCG47_RS12825 (2685171) | 2685171..2685668 | + | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
| QCG47_RS12830 (2685892) | 2685892..2687604 | - | 1713 | Protein_2484 | flagellar biosynthesis protein FlhA | - |
| QCG47_RS12835 (2687576) | 2687576..2688361 | + | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| QCG47_RS12840 (2688432) | 2688432..2689487 | + | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| QCG47_RS12845 (2689539) | 2689539..2689832 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| QCG47_RS12850 (2689835) | 2689835..2690233 | + | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| QCG47_RS12855 (2690243) | 2690243..2690695 | + | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| QCG47_RS12860 (2691013) | 2691013..2691219 | + | 207 | Protein_2490 | RtcB family protein | - |
| QCG47_RS12865 (2691215) | 2691215..2691736 | + | 522 | Protein_2491 | peptide chain release factor H | - |
| QCG47_RS12870 (2691793) | 2691793..2693250 | - | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| QCG47_RS12875 (2693511) | 2693511..2693969 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| - (2694565) | 2694565..2694645 | + | 81 | NuclAT_12 | - | - |
| - (2694565) | 2694565..2694645 | + | 81 | NuclAT_12 | - | - |
| - (2694565) | 2694565..2694645 | + | 81 | NuclAT_12 | - | - |
| - (2694565) | 2694565..2694645 | + | 81 | NuclAT_12 | - | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T276763 WP_001263489.1 NZ_CP122319:2689835-2690233 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |