Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1502917..1503139 | Replicon | chromosome |
Accession | NZ_CP122319 | ||
Organism | Escherichia coli strain BW25113 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1E8T8 |
Locus tag | QCG47_RS07200 | Protein ID | WP_000141634.1 |
Coordinates | 1502917..1503024 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1503073..1503139 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG47_RS07175 | 1498170..1498898 | - | 729 | WP_011310329.1 | cellulose biosynthesis protein BcsQ | - |
QCG47_RS07180 | 1498934..1499122 | - | 189 | WP_001063318.1 | cellulose biosynthesis protein BcsR | - |
QCG47_RS07185 | 1499395..1500966 | + | 1572 | WP_001204931.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
QCG47_RS07190 | 1500963..1501154 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
QCG47_RS07195 | 1501151..1502830 | + | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
QCG47_RS07200 | 1502917..1503024 | - | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
- | 1503073..1503139 | + | 67 | - | - | Antitoxin |
QCG47_RS07205 | 1503500..1504771 | + | 1272 | WP_001295225.1 | aromatic amino acid transport family protein | - |
QCG47_RS07210 | 1504801..1505805 | - | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
QCG47_RS07215 | 1505802..1506785 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
QCG47_RS07220 | 1506796..1507698 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T276754 WP_000141634.1 NZ_CP122319:c1503024-1502917 [Escherichia coli]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT276754 NZ_CP122319:1503073-1503139 [Escherichia coli]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|