Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 970787..971480 | Replicon | chromosome |
| Accession | NZ_CP122319 | ||
| Organism | Escherichia coli strain BW25113 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | QCG47_RS04590 | Protein ID | WP_000415584.1 |
| Coordinates | 971184..971480 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | QCG47_RS04585 | Protein ID | WP_000650107.1 |
| Coordinates | 970787..971182 (-) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCG47_RS04575 (966651) | 966651..968909 | - | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
| QCG47_RS04580 (969047) | 969047..970654 | - | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
| QCG47_RS04585 (970787) | 970787..971182 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| QCG47_RS04590 (971184) | 971184..971480 | - | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| QCG47_RS04595 (971685) | 971685..972167 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| QCG47_RS04600 (972220) | 972220..972612 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| QCG47_RS04605 (972764) | 972764..973423 | + | 660 | WP_001221495.1 | quorum sensing response regulator transcription factor QseB | - |
| QCG47_RS04610 (973420) | 973420..974769 | + | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
| QCG47_RS04615 (974815) | 974815..975147 | - | 333 | WP_000917684.1 | DUF2645 family protein | - |
| QCG47_RS04620 (975466) | 975466..976047 | + | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| QCG47_RS04625 (976078) | 976078..976392 | + | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T276751 WP_000415584.1 NZ_CP122319:c971480-971184 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT276751 WP_000650107.1 NZ_CP122319:c971182-970787 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|