Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 4376665..4377358 | Replicon | chromosome |
Accession | NZ_CP122318 | ||
Organism | Escherichia coli strain HT873X1 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | QCG45_RS21470 | Protein ID | WP_000415584.1 |
Coordinates | 4376665..4376961 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | QCG45_RS21475 | Protein ID | WP_000650107.1 |
Coordinates | 4376963..4377358 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG45_RS21435 (4371753) | 4371753..4372067 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
QCG45_RS21440 (4372098) | 4372098..4372679 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
QCG45_RS21445 (4372998) | 4372998..4373330 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
QCG45_RS21450 (4373376) | 4373376..4374725 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
QCG45_RS21455 (4374722) | 4374722..4375381 | - | 660 | WP_001221495.1 | quorum sensing response regulator transcription factor QseB | - |
QCG45_RS21460 (4375533) | 4375533..4375925 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
QCG45_RS21465 (4375978) | 4375978..4376460 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
QCG45_RS21470 (4376665) | 4376665..4376961 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
QCG45_RS21475 (4376963) | 4376963..4377358 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
QCG45_RS21480 (4377491) | 4377491..4379098 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
QCG45_RS21485 (4379236) | 4379236..4381494 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T276745 WP_000415584.1 NZ_CP122318:4376665-4376961 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT276745 WP_000650107.1 NZ_CP122318:4376963-4377358 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|