Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 2254740..2255434 | Replicon | chromosome |
Accession | NZ_CP122318 | ||
Organism | Escherichia coli strain HT873X1 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | QCG45_RS11160 | Protein ID | WP_001263489.1 |
Coordinates | 2255036..2255434 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | QCG45_RS11155 | Protein ID | WP_000554758.1 |
Coordinates | 2254740..2255033 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG45_RS11135 (2250372) | 2250372..2250869 | + | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
QCG45_RS11140 (2251093) | 2251093..2252805 | - | 1713 | Protein_2170 | flagellar biosynthesis protein FlhA | - |
QCG45_RS11145 (2252777) | 2252777..2253562 | + | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
QCG45_RS11150 (2253633) | 2253633..2254688 | + | 1056 | WP_001226164.1 | DNA polymerase IV | - |
QCG45_RS11155 (2254740) | 2254740..2255033 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
QCG45_RS11160 (2255036) | 2255036..2255434 | + | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
QCG45_RS11165 (2255444) | 2255444..2255896 | + | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
QCG45_RS11170 (2256214) | 2256214..2256420 | + | 207 | Protein_2176 | RtcB family protein | - |
QCG45_RS11175 (2256416) | 2256416..2256937 | + | 522 | Protein_2177 | peptide chain release factor H | - |
QCG45_RS11180 (2256994) | 2256994..2258451 | - | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
QCG45_RS11185 (2258712) | 2258712..2259170 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
- (2259766) | 2259766..2259846 | + | 81 | NuclAT_12 | - | - |
- (2259766) | 2259766..2259846 | + | 81 | NuclAT_12 | - | - |
- (2259766) | 2259766..2259846 | + | 81 | NuclAT_12 | - | - |
- (2259766) | 2259766..2259846 | + | 81 | NuclAT_12 | - | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T276733 WP_001263489.1 NZ_CP122318:2255036-2255434 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |