Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4408732..4408954 Replicon chromosome
Accession NZ_CP122317
Organism Escherichia coli strain HT-948

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag QCG49_RS21500 Protein ID WP_000170955.1
Coordinates 4408732..4408839 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4408887..4408954 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QCG49_RS21470 (4404588) 4404588..4405421 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
QCG49_RS21475 (4405418) 4405418..4405810 + 393 WP_000200374.1 invasion regulator SirB2 -
QCG49_RS21480 (4405814) 4405814..4406623 + 810 WP_001257044.1 invasion regulator SirB1 -
QCG49_RS21485 (4406659) 4406659..4407513 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QCG49_RS21490 (4407662) 4407662..4407769 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (4407817) 4407817..4407883 + 67 NuclAT_34 - -
- (4407817) 4407817..4407883 + 67 NuclAT_34 - -
- (4407817) 4407817..4407883 + 67 NuclAT_34 - -
- (4407817) 4407817..4407883 + 67 NuclAT_34 - -
- (4407817) 4407817..4407883 + 67 NuclAT_36 - -
- (4407817) 4407817..4407883 + 67 NuclAT_36 - -
- (4407817) 4407817..4407883 + 67 NuclAT_36 - -
- (4407817) 4407817..4407883 + 67 NuclAT_36 - -
- (4407817) 4407817..4407883 + 67 NuclAT_38 - -
- (4407817) 4407817..4407883 + 67 NuclAT_38 - -
- (4407817) 4407817..4407883 + 67 NuclAT_38 - -
- (4407817) 4407817..4407883 + 67 NuclAT_38 - -
- (4407817) 4407817..4407883 + 67 NuclAT_40 - -
- (4407817) 4407817..4407883 + 67 NuclAT_40 - -
- (4407817) 4407817..4407883 + 67 NuclAT_40 - -
- (4407817) 4407817..4407883 + 67 NuclAT_40 - -
- (4407817) 4407817..4407883 + 67 NuclAT_42 - -
- (4407817) 4407817..4407883 + 67 NuclAT_42 - -
- (4407817) 4407817..4407883 + 67 NuclAT_42 - -
- (4407817) 4407817..4407883 + 67 NuclAT_42 - -
- (4407817) 4407817..4407883 + 67 NuclAT_44 - -
- (4407817) 4407817..4407883 + 67 NuclAT_44 - -
- (4407817) 4407817..4407883 + 67 NuclAT_44 - -
- (4407817) 4407817..4407883 + 67 NuclAT_44 - -
- (4407819) 4407819..4407884 + 66 NuclAT_18 - -
- (4407819) 4407819..4407884 + 66 NuclAT_18 - -
- (4407819) 4407819..4407884 + 66 NuclAT_18 - -
- (4407819) 4407819..4407884 + 66 NuclAT_18 - -
- (4407819) 4407819..4407884 + 66 NuclAT_21 - -
- (4407819) 4407819..4407884 + 66 NuclAT_21 - -
- (4407819) 4407819..4407884 + 66 NuclAT_21 - -
- (4407819) 4407819..4407884 + 66 NuclAT_21 - -
- (4407819) 4407819..4407884 + 66 NuclAT_24 - -
- (4407819) 4407819..4407884 + 66 NuclAT_24 - -
- (4407819) 4407819..4407884 + 66 NuclAT_24 - -
- (4407819) 4407819..4407884 + 66 NuclAT_24 - -
- (4407819) 4407819..4407884 + 66 NuclAT_27 - -
- (4407819) 4407819..4407884 + 66 NuclAT_27 - -
- (4407819) 4407819..4407884 + 66 NuclAT_27 - -
- (4407819) 4407819..4407884 + 66 NuclAT_27 - -
- (4407819) 4407819..4407884 + 66 NuclAT_30 - -
- (4407819) 4407819..4407884 + 66 NuclAT_30 - -
- (4407819) 4407819..4407884 + 66 NuclAT_30 - -
- (4407819) 4407819..4407884 + 66 NuclAT_30 - -
- (4407819) 4407819..4407884 + 66 NuclAT_33 - -
- (4407819) 4407819..4407884 + 66 NuclAT_33 - -
- (4407819) 4407819..4407884 + 66 NuclAT_33 - -
- (4407819) 4407819..4407884 + 66 NuclAT_33 - -
QCG49_RS21495 (4408197) 4408197..4408304 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein -
- (4408353) 4408353..4408418 + 66 NuclAT_35 - -
- (4408353) 4408353..4408418 + 66 NuclAT_35 - -
- (4408353) 4408353..4408418 + 66 NuclAT_35 - -
- (4408353) 4408353..4408418 + 66 NuclAT_35 - -
- (4408353) 4408353..4408418 + 66 NuclAT_37 - -
- (4408353) 4408353..4408418 + 66 NuclAT_37 - -
- (4408353) 4408353..4408418 + 66 NuclAT_37 - -
- (4408353) 4408353..4408418 + 66 NuclAT_37 - -
- (4408353) 4408353..4408418 + 66 NuclAT_39 - -
- (4408353) 4408353..4408418 + 66 NuclAT_39 - -
- (4408353) 4408353..4408418 + 66 NuclAT_39 - -
- (4408353) 4408353..4408418 + 66 NuclAT_39 - -
- (4408353) 4408353..4408418 + 66 NuclAT_41 - -
- (4408353) 4408353..4408418 + 66 NuclAT_41 - -
- (4408353) 4408353..4408418 + 66 NuclAT_41 - -
- (4408353) 4408353..4408418 + 66 NuclAT_41 - -
- (4408353) 4408353..4408418 + 66 NuclAT_43 - -
- (4408353) 4408353..4408418 + 66 NuclAT_43 - -
- (4408353) 4408353..4408418 + 66 NuclAT_43 - -
- (4408353) 4408353..4408418 + 66 NuclAT_43 - -
- (4408353) 4408353..4408418 + 66 NuclAT_45 - -
- (4408353) 4408353..4408418 + 66 NuclAT_45 - -
- (4408353) 4408353..4408418 + 66 NuclAT_45 - -
- (4408353) 4408353..4408418 + 66 NuclAT_45 - -
- (4408352) 4408352..4408419 + 68 NuclAT_17 - -
- (4408352) 4408352..4408419 + 68 NuclAT_17 - -
- (4408352) 4408352..4408419 + 68 NuclAT_17 - -
- (4408352) 4408352..4408419 + 68 NuclAT_17 - -
- (4408352) 4408352..4408419 + 68 NuclAT_20 - -
- (4408352) 4408352..4408419 + 68 NuclAT_20 - -
- (4408352) 4408352..4408419 + 68 NuclAT_20 - -
- (4408352) 4408352..4408419 + 68 NuclAT_20 - -
- (4408352) 4408352..4408419 + 68 NuclAT_23 - -
- (4408352) 4408352..4408419 + 68 NuclAT_23 - -
- (4408352) 4408352..4408419 + 68 NuclAT_23 - -
- (4408352) 4408352..4408419 + 68 NuclAT_23 - -
- (4408352) 4408352..4408419 + 68 NuclAT_26 - -
- (4408352) 4408352..4408419 + 68 NuclAT_26 - -
- (4408352) 4408352..4408419 + 68 NuclAT_26 - -
- (4408352) 4408352..4408419 + 68 NuclAT_26 - -
- (4408352) 4408352..4408419 + 68 NuclAT_29 - -
- (4408352) 4408352..4408419 + 68 NuclAT_29 - -
- (4408352) 4408352..4408419 + 68 NuclAT_29 - -
- (4408352) 4408352..4408419 + 68 NuclAT_29 - -
- (4408352) 4408352..4408419 + 68 NuclAT_32 - -
- (4408352) 4408352..4408419 + 68 NuclAT_32 - -
- (4408352) 4408352..4408419 + 68 NuclAT_32 - -
- (4408352) 4408352..4408419 + 68 NuclAT_32 - -
QCG49_RS21500 (4408732) 4408732..4408839 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4408887) 4408887..4408954 + 68 NuclAT_16 - Antitoxin
- (4408887) 4408887..4408954 + 68 NuclAT_16 - Antitoxin
- (4408887) 4408887..4408954 + 68 NuclAT_16 - Antitoxin
- (4408887) 4408887..4408954 + 68 NuclAT_16 - Antitoxin
- (4408887) 4408887..4408954 + 68 NuclAT_19 - Antitoxin
- (4408887) 4408887..4408954 + 68 NuclAT_19 - Antitoxin
- (4408887) 4408887..4408954 + 68 NuclAT_19 - Antitoxin
- (4408887) 4408887..4408954 + 68 NuclAT_19 - Antitoxin
- (4408887) 4408887..4408954 + 68 NuclAT_22 - Antitoxin
- (4408887) 4408887..4408954 + 68 NuclAT_22 - Antitoxin
- (4408887) 4408887..4408954 + 68 NuclAT_22 - Antitoxin
- (4408887) 4408887..4408954 + 68 NuclAT_22 - Antitoxin
- (4408887) 4408887..4408954 + 68 NuclAT_25 - Antitoxin
- (4408887) 4408887..4408954 + 68 NuclAT_25 - Antitoxin
- (4408887) 4408887..4408954 + 68 NuclAT_25 - Antitoxin
- (4408887) 4408887..4408954 + 68 NuclAT_25 - Antitoxin
- (4408887) 4408887..4408954 + 68 NuclAT_28 - Antitoxin
- (4408887) 4408887..4408954 + 68 NuclAT_28 - Antitoxin
- (4408887) 4408887..4408954 + 68 NuclAT_28 - Antitoxin
- (4408887) 4408887..4408954 + 68 NuclAT_28 - Antitoxin
- (4408887) 4408887..4408954 + 68 NuclAT_31 - Antitoxin
- (4408887) 4408887..4408954 + 68 NuclAT_31 - Antitoxin
- (4408887) 4408887..4408954 + 68 NuclAT_31 - Antitoxin
- (4408887) 4408887..4408954 + 68 NuclAT_31 - Antitoxin
QCG49_RS21505 (4409243) 4409243..4410343 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
QCG49_RS21510 (4410613) 4410613..4410843 + 231 WP_001146444.1 putative cation transport regulator ChaB -
QCG49_RS21515 (4411001) 4411001..4411696 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
QCG49_RS21520 (4411740) 4411740..4412093 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
QCG49_RS21525 (4412278) 4412278..4413672 + 1395 WP_000086217.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T276714 WP_000170955.1 NZ_CP122317:c4408839-4408732 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 68 bp

>AT276714 NZ_CP122317:4408887-4408954 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829J2A9

Antitoxin

Download structure file

References