Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3796577..3797271 | Replicon | chromosome |
Accession | NZ_CP122317 | ||
Organism | Escherichia coli strain HT-948 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | QCG49_RS18410 | Protein ID | WP_001263489.1 |
Coordinates | 3796577..3796975 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | QCG49_RS18415 | Protein ID | WP_000554758.1 |
Coordinates | 3796978..3797271 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3792165) | 3792165..3792245 | - | 81 | NuclAT_12 | - | - |
- (3792165) | 3792165..3792245 | - | 81 | NuclAT_12 | - | - |
- (3792165) | 3792165..3792245 | - | 81 | NuclAT_12 | - | - |
- (3792165) | 3792165..3792245 | - | 81 | NuclAT_12 | - | - |
QCG49_RS18385 (3792841) | 3792841..3793299 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
QCG49_RS18390 (3793560) | 3793560..3795017 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
QCG49_RS18395 (3795074) | 3795074..3795595 | - | 522 | Protein_3583 | peptide chain release factor H | - |
QCG49_RS18400 (3795591) | 3795591..3795797 | - | 207 | Protein_3584 | RtcB family protein | - |
QCG49_RS18405 (3796115) | 3796115..3796567 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
QCG49_RS18410 (3796577) | 3796577..3796975 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
QCG49_RS18415 (3796978) | 3796978..3797271 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
QCG49_RS18420 (3797323) | 3797323..3798378 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
QCG49_RS18425 (3798449) | 3798449..3799234 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
QCG49_RS18430 (3799206) | 3799206..3800918 | + | 1713 | Protein_3590 | flagellar biosynthesis protein FlhA | - |
QCG49_RS18435 (3801142) | 3801142..3801639 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T276709 WP_001263489.1 NZ_CP122317:c3796975-3796577 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |