Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 4344866..4345559 | Replicon | chromosome |
Accession | NZ_CP122316 | ||
Organism | Escherichia coli strain HT-946 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | QCG48_RS21335 | Protein ID | WP_000415584.1 |
Coordinates | 4344866..4345162 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | QCG48_RS21340 | Protein ID | WP_000650107.1 |
Coordinates | 4345164..4345559 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG48_RS21300 (4339954) | 4339954..4340268 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
QCG48_RS21305 (4340299) | 4340299..4340880 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
QCG48_RS21310 (4341199) | 4341199..4341531 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
QCG48_RS21315 (4341577) | 4341577..4342926 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
QCG48_RS21320 (4342923) | 4342923..4343582 | - | 660 | WP_001221495.1 | quorum sensing response regulator transcription factor QseB | - |
QCG48_RS21325 (4343734) | 4343734..4344126 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
QCG48_RS21330 (4344179) | 4344179..4344661 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
QCG48_RS21335 (4344866) | 4344866..4345162 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
QCG48_RS21340 (4345164) | 4345164..4345559 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
QCG48_RS21345 (4345692) | 4345692..4347299 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
QCG48_RS21350 (4347437) | 4347437..4349695 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T276683 WP_000415584.1 NZ_CP122316:4344866-4345162 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT276683 WP_000650107.1 NZ_CP122316:4345164-4345559 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|