Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 3813207..3813429 | Replicon | chromosome |
Accession | NZ_CP122316 | ||
Organism | Escherichia coli strain HT-946 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1E8T8 |
Locus tag | QCG48_RS18725 | Protein ID | WP_000141634.1 |
Coordinates | 3813322..3813429 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 3813207..3813273 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG48_RS18705 | 3808648..3809550 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
QCG48_RS18710 | 3809561..3810544 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
QCG48_RS18715 | 3810541..3811545 | + | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
QCG48_RS18720 | 3811575..3812846 | - | 1272 | WP_001295225.1 | aromatic amino acid transport family protein | - |
- | 3813207..3813273 | - | 67 | - | - | Antitoxin |
QCG48_RS18725 | 3813322..3813429 | + | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
QCG48_RS18730 | 3813516..3815195 | - | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
QCG48_RS18735 | 3815192..3815383 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
QCG48_RS18740 | 3815380..3816951 | - | 1572 | WP_001204931.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
QCG48_RS18745 | 3817224..3817412 | + | 189 | WP_001063318.1 | cellulose biosynthesis protein BcsR | - |
QCG48_RS18750 | 3817448..3818176 | + | 729 | WP_011310329.1 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T276680 WP_000141634.1 NZ_CP122316:3813322-3813429 [Escherichia coli]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T276680 NZ_CP122316:3813322-3813429 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT276680 NZ_CP122316:c3813273-3813207 [Escherichia coli]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|