Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 2221324..2222018 | Replicon | chromosome |
Accession | NZ_CP122316 | ||
Organism | Escherichia coli strain HT-946 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | QCG48_RS11030 | Protein ID | WP_001263489.1 |
Coordinates | 2221620..2222018 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | QCG48_RS11025 | Protein ID | WP_000554758.1 |
Coordinates | 2221324..2221617 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG48_RS11005 (2216956) | 2216956..2217453 | + | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
QCG48_RS11010 (2217677) | 2217677..2219389 | - | 1713 | Protein_2144 | flagellar biosynthesis protein FlhA | - |
QCG48_RS11015 (2219361) | 2219361..2220146 | + | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
QCG48_RS11020 (2220217) | 2220217..2221272 | + | 1056 | WP_001226164.1 | DNA polymerase IV | - |
QCG48_RS11025 (2221324) | 2221324..2221617 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
QCG48_RS11030 (2221620) | 2221620..2222018 | + | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
QCG48_RS11035 (2222028) | 2222028..2222480 | + | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
QCG48_RS11040 (2222798) | 2222798..2223004 | + | 207 | Protein_2150 | RtcB family protein | - |
QCG48_RS11045 (2223000) | 2223000..2223521 | + | 522 | Protein_2151 | peptide chain release factor H | - |
QCG48_RS11050 (2223578) | 2223578..2225035 | - | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
QCG48_RS11055 (2225296) | 2225296..2225754 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
- (2226350) | 2226350..2226430 | + | 81 | NuclAT_12 | - | - |
- (2226350) | 2226350..2226430 | + | 81 | NuclAT_12 | - | - |
- (2226350) | 2226350..2226430 | + | 81 | NuclAT_12 | - | - |
- (2226350) | 2226350..2226430 | + | 81 | NuclAT_12 | - | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T276671 WP_001263489.1 NZ_CP122316:2221620-2222018 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |