Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2682351..2682573 | Replicon | chromosome |
| Accession | NZ_CP122315 | ||
| Organism | Escherichia coli strain HT-947 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | J7R083 |
| Locus tag | QCG46_RS13140 | Protein ID | WP_000170963.1 |
| Coordinates | 2682351..2682458 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2682506..2682573 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCG46_RS13110 (2677660) | 2677660..2678742 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| QCG46_RS13115 (2678742) | 2678742..2679575 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| QCG46_RS13120 (2679572) | 2679572..2679964 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| QCG46_RS13125 (2679968) | 2679968..2680777 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| QCG46_RS13130 (2680813) | 2680813..2681667 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| QCG46_RS13135 (2681816) | 2681816..2681923 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (2681971) | 2681971..2682037 | + | 67 | NuclAT_34 | - | - |
| - (2681971) | 2681971..2682037 | + | 67 | NuclAT_34 | - | - |
| - (2681971) | 2681971..2682037 | + | 67 | NuclAT_34 | - | - |
| - (2681971) | 2681971..2682037 | + | 67 | NuclAT_34 | - | - |
| - (2681971) | 2681971..2682037 | + | 67 | NuclAT_36 | - | - |
| - (2681971) | 2681971..2682037 | + | 67 | NuclAT_36 | - | - |
| - (2681971) | 2681971..2682037 | + | 67 | NuclAT_36 | - | - |
| - (2681971) | 2681971..2682037 | + | 67 | NuclAT_36 | - | - |
| - (2681971) | 2681971..2682037 | + | 67 | NuclAT_38 | - | - |
| - (2681971) | 2681971..2682037 | + | 67 | NuclAT_38 | - | - |
| - (2681971) | 2681971..2682037 | + | 67 | NuclAT_38 | - | - |
| - (2681971) | 2681971..2682037 | + | 67 | NuclAT_38 | - | - |
| - (2681971) | 2681971..2682037 | + | 67 | NuclAT_40 | - | - |
| - (2681971) | 2681971..2682037 | + | 67 | NuclAT_40 | - | - |
| - (2681971) | 2681971..2682037 | + | 67 | NuclAT_40 | - | - |
| - (2681971) | 2681971..2682037 | + | 67 | NuclAT_40 | - | - |
| - (2681971) | 2681971..2682037 | + | 67 | NuclAT_42 | - | - |
| - (2681971) | 2681971..2682037 | + | 67 | NuclAT_42 | - | - |
| - (2681971) | 2681971..2682037 | + | 67 | NuclAT_42 | - | - |
| - (2681971) | 2681971..2682037 | + | 67 | NuclAT_42 | - | - |
| - (2681971) | 2681971..2682037 | + | 67 | NuclAT_44 | - | - |
| - (2681971) | 2681971..2682037 | + | 67 | NuclAT_44 | - | - |
| - (2681971) | 2681971..2682037 | + | 67 | NuclAT_44 | - | - |
| - (2681971) | 2681971..2682037 | + | 67 | NuclAT_44 | - | - |
| - (2681973) | 2681973..2682038 | + | 66 | NuclAT_18 | - | - |
| - (2681973) | 2681973..2682038 | + | 66 | NuclAT_18 | - | - |
| - (2681973) | 2681973..2682038 | + | 66 | NuclAT_18 | - | - |
| - (2681973) | 2681973..2682038 | + | 66 | NuclAT_18 | - | - |
| - (2681973) | 2681973..2682038 | + | 66 | NuclAT_21 | - | - |
| - (2681973) | 2681973..2682038 | + | 66 | NuclAT_21 | - | - |
| - (2681973) | 2681973..2682038 | + | 66 | NuclAT_21 | - | - |
| - (2681973) | 2681973..2682038 | + | 66 | NuclAT_21 | - | - |
| - (2681973) | 2681973..2682038 | + | 66 | NuclAT_24 | - | - |
| - (2681973) | 2681973..2682038 | + | 66 | NuclAT_24 | - | - |
| - (2681973) | 2681973..2682038 | + | 66 | NuclAT_24 | - | - |
| - (2681973) | 2681973..2682038 | + | 66 | NuclAT_24 | - | - |
| - (2681973) | 2681973..2682038 | + | 66 | NuclAT_27 | - | - |
| - (2681973) | 2681973..2682038 | + | 66 | NuclAT_27 | - | - |
| - (2681973) | 2681973..2682038 | + | 66 | NuclAT_27 | - | - |
| - (2681973) | 2681973..2682038 | + | 66 | NuclAT_27 | - | - |
| - (2681973) | 2681973..2682038 | + | 66 | NuclAT_30 | - | - |
| - (2681973) | 2681973..2682038 | + | 66 | NuclAT_30 | - | - |
| - (2681973) | 2681973..2682038 | + | 66 | NuclAT_30 | - | - |
| - (2681973) | 2681973..2682038 | + | 66 | NuclAT_30 | - | - |
| - (2681973) | 2681973..2682038 | + | 66 | NuclAT_33 | - | - |
| - (2681973) | 2681973..2682038 | + | 66 | NuclAT_33 | - | - |
| - (2681973) | 2681973..2682038 | + | 66 | NuclAT_33 | - | - |
| - (2681973) | 2681973..2682038 | + | 66 | NuclAT_33 | - | - |
| QCG46_RS13140 (2682351) | 2682351..2682458 | - | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (2682507) | 2682507..2682572 | + | 66 | NuclAT_35 | - | - |
| - (2682507) | 2682507..2682572 | + | 66 | NuclAT_35 | - | - |
| - (2682507) | 2682507..2682572 | + | 66 | NuclAT_35 | - | - |
| - (2682507) | 2682507..2682572 | + | 66 | NuclAT_35 | - | - |
| - (2682507) | 2682507..2682572 | + | 66 | NuclAT_37 | - | - |
| - (2682507) | 2682507..2682572 | + | 66 | NuclAT_37 | - | - |
| - (2682507) | 2682507..2682572 | + | 66 | NuclAT_37 | - | - |
| - (2682507) | 2682507..2682572 | + | 66 | NuclAT_37 | - | - |
| - (2682507) | 2682507..2682572 | + | 66 | NuclAT_39 | - | - |
| - (2682507) | 2682507..2682572 | + | 66 | NuclAT_39 | - | - |
| - (2682507) | 2682507..2682572 | + | 66 | NuclAT_39 | - | - |
| - (2682507) | 2682507..2682572 | + | 66 | NuclAT_39 | - | - |
| - (2682507) | 2682507..2682572 | + | 66 | NuclAT_41 | - | - |
| - (2682507) | 2682507..2682572 | + | 66 | NuclAT_41 | - | - |
| - (2682507) | 2682507..2682572 | + | 66 | NuclAT_41 | - | - |
| - (2682507) | 2682507..2682572 | + | 66 | NuclAT_41 | - | - |
| - (2682507) | 2682507..2682572 | + | 66 | NuclAT_43 | - | - |
| - (2682507) | 2682507..2682572 | + | 66 | NuclAT_43 | - | - |
| - (2682507) | 2682507..2682572 | + | 66 | NuclAT_43 | - | - |
| - (2682507) | 2682507..2682572 | + | 66 | NuclAT_43 | - | - |
| - (2682507) | 2682507..2682572 | + | 66 | NuclAT_45 | - | - |
| - (2682507) | 2682507..2682572 | + | 66 | NuclAT_45 | - | - |
| - (2682507) | 2682507..2682572 | + | 66 | NuclAT_45 | - | - |
| - (2682507) | 2682507..2682572 | + | 66 | NuclAT_45 | - | - |
| - (2682506) | 2682506..2682573 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (2682506) | 2682506..2682573 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (2682506) | 2682506..2682573 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (2682506) | 2682506..2682573 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (2682506) | 2682506..2682573 | + | 68 | NuclAT_20 | - | Antitoxin |
| - (2682506) | 2682506..2682573 | + | 68 | NuclAT_20 | - | Antitoxin |
| - (2682506) | 2682506..2682573 | + | 68 | NuclAT_20 | - | Antitoxin |
| - (2682506) | 2682506..2682573 | + | 68 | NuclAT_20 | - | Antitoxin |
| - (2682506) | 2682506..2682573 | + | 68 | NuclAT_23 | - | Antitoxin |
| - (2682506) | 2682506..2682573 | + | 68 | NuclAT_23 | - | Antitoxin |
| - (2682506) | 2682506..2682573 | + | 68 | NuclAT_23 | - | Antitoxin |
| - (2682506) | 2682506..2682573 | + | 68 | NuclAT_23 | - | Antitoxin |
| - (2682506) | 2682506..2682573 | + | 68 | NuclAT_26 | - | Antitoxin |
| - (2682506) | 2682506..2682573 | + | 68 | NuclAT_26 | - | Antitoxin |
| - (2682506) | 2682506..2682573 | + | 68 | NuclAT_26 | - | Antitoxin |
| - (2682506) | 2682506..2682573 | + | 68 | NuclAT_26 | - | Antitoxin |
| - (2682506) | 2682506..2682573 | + | 68 | NuclAT_29 | - | Antitoxin |
| - (2682506) | 2682506..2682573 | + | 68 | NuclAT_29 | - | Antitoxin |
| - (2682506) | 2682506..2682573 | + | 68 | NuclAT_29 | - | Antitoxin |
| - (2682506) | 2682506..2682573 | + | 68 | NuclAT_29 | - | Antitoxin |
| - (2682506) | 2682506..2682573 | + | 68 | NuclAT_32 | - | Antitoxin |
| - (2682506) | 2682506..2682573 | + | 68 | NuclAT_32 | - | Antitoxin |
| - (2682506) | 2682506..2682573 | + | 68 | NuclAT_32 | - | Antitoxin |
| - (2682506) | 2682506..2682573 | + | 68 | NuclAT_32 | - | Antitoxin |
| QCG46_RS13145 (2682886) | 2682886..2682993 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (2683041) | 2683041..2683108 | + | 68 | NuclAT_16 | - | - |
| - (2683041) | 2683041..2683108 | + | 68 | NuclAT_16 | - | - |
| - (2683041) | 2683041..2683108 | + | 68 | NuclAT_16 | - | - |
| - (2683041) | 2683041..2683108 | + | 68 | NuclAT_16 | - | - |
| - (2683041) | 2683041..2683108 | + | 68 | NuclAT_19 | - | - |
| - (2683041) | 2683041..2683108 | + | 68 | NuclAT_19 | - | - |
| - (2683041) | 2683041..2683108 | + | 68 | NuclAT_19 | - | - |
| - (2683041) | 2683041..2683108 | + | 68 | NuclAT_19 | - | - |
| - (2683041) | 2683041..2683108 | + | 68 | NuclAT_22 | - | - |
| - (2683041) | 2683041..2683108 | + | 68 | NuclAT_22 | - | - |
| - (2683041) | 2683041..2683108 | + | 68 | NuclAT_22 | - | - |
| - (2683041) | 2683041..2683108 | + | 68 | NuclAT_22 | - | - |
| - (2683041) | 2683041..2683108 | + | 68 | NuclAT_25 | - | - |
| - (2683041) | 2683041..2683108 | + | 68 | NuclAT_25 | - | - |
| - (2683041) | 2683041..2683108 | + | 68 | NuclAT_25 | - | - |
| - (2683041) | 2683041..2683108 | + | 68 | NuclAT_25 | - | - |
| - (2683041) | 2683041..2683108 | + | 68 | NuclAT_28 | - | - |
| - (2683041) | 2683041..2683108 | + | 68 | NuclAT_28 | - | - |
| - (2683041) | 2683041..2683108 | + | 68 | NuclAT_28 | - | - |
| - (2683041) | 2683041..2683108 | + | 68 | NuclAT_28 | - | - |
| - (2683041) | 2683041..2683108 | + | 68 | NuclAT_31 | - | - |
| - (2683041) | 2683041..2683108 | + | 68 | NuclAT_31 | - | - |
| - (2683041) | 2683041..2683108 | + | 68 | NuclAT_31 | - | - |
| - (2683041) | 2683041..2683108 | + | 68 | NuclAT_31 | - | - |
| QCG46_RS13150 (2683397) | 2683397..2684497 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
| QCG46_RS13155 (2684767) | 2684767..2684997 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| QCG46_RS13160 (2685155) | 2685155..2685850 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| QCG46_RS13165 (2685894) | 2685894..2686247 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T276636 WP_000170963.1 NZ_CP122315:c2682458-2682351 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 68 bp
>AT276636 NZ_CP122315:2682506-2682573 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|