Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 2070731..2071425 | Replicon | chromosome |
Accession | NZ_CP122315 | ||
Organism | Escherichia coli strain HT-947 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | QCG46_RS10050 | Protein ID | WP_001263489.1 |
Coordinates | 2070731..2071129 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | QCG46_RS10055 | Protein ID | WP_000554758.1 |
Coordinates | 2071132..2071425 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (2066319) | 2066319..2066399 | - | 81 | NuclAT_12 | - | - |
- (2066319) | 2066319..2066399 | - | 81 | NuclAT_12 | - | - |
- (2066319) | 2066319..2066399 | - | 81 | NuclAT_12 | - | - |
- (2066319) | 2066319..2066399 | - | 81 | NuclAT_12 | - | - |
QCG46_RS10025 (2066995) | 2066995..2067453 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
QCG46_RS10030 (2067714) | 2067714..2069171 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
QCG46_RS10035 (2069228) | 2069228..2069749 | - | 522 | Protein_1948 | peptide chain release factor H | - |
QCG46_RS10040 (2069745) | 2069745..2069951 | - | 207 | Protein_1949 | RtcB family protein | - |
QCG46_RS10045 (2070269) | 2070269..2070721 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
QCG46_RS10050 (2070731) | 2070731..2071129 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
QCG46_RS10055 (2071132) | 2071132..2071425 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
QCG46_RS10060 (2071477) | 2071477..2072532 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
QCG46_RS10065 (2072603) | 2072603..2073388 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
QCG46_RS10070 (2073360) | 2073360..2075072 | + | 1713 | Protein_1955 | flagellar biosynthesis protein FlhA | - |
QCG46_RS10075 (2075296) | 2075296..2075793 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T276634 WP_001263489.1 NZ_CP122315:c2071129-2070731 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |