Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 56648..57447 | Replicon | chromosome |
| Accession | NZ_CP122315 | ||
| Organism | Escherichia coli strain HT-947 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V0SSH7 |
| Locus tag | QCG46_RS00280 | Protein ID | WP_000347273.1 |
| Coordinates | 56983..57447 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | QCG46_RS00275 | Protein ID | WP_001307405.1 |
| Coordinates | 56648..56983 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCG46_RS00260 (52433) | 52433..53203 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| QCG46_RS00265 (53219) | 53219..54553 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| QCG46_RS00270 (54928) | 54928..56499 | + | 1572 | WP_001273753.1 | galactarate dehydratase | - |
| QCG46_RS00275 (56648) | 56648..56983 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| QCG46_RS00280 (56983) | 56983..57447 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| QCG46_RS00285 (57502) | 57502..58311 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| QCG46_RS00290 (58560) | 58560..59840 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| QCG46_RS00295 (59863) | 59863..60336 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| QCG46_RS00300 (60347) | 60347..60718 | + | 372 | Protein_58 | PTS sugar transporter subunit IIC | - |
| QCG46_RS00305 (60714) | 60714..61271 | + | 558 | Protein_59 | amidohydrolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T276626 WP_000347273.1 NZ_CP122315:56983-57447 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SSH7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |