Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 13374..14101 | Replicon | chromosome |
Accession | NZ_CP122315 | ||
Organism | Escherichia coli strain HT-947 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | QCG46_RS00055 | Protein ID | WP_000550189.1 |
Coordinates | 13787..14101 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QCG46_RS00050 | Protein ID | WP_000560266.1 |
Coordinates | 13374..13790 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG46_RS00040 (8534) | 8534..10885 | + | 2352 | WP_000695487.1 | alpha-glucosidase | - |
QCG46_RS00045 (11311) | 11311..13329 | + | 2019 | WP_000121433.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
QCG46_RS00050 (13374) | 13374..13790 | - | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
QCG46_RS00055 (13787) | 13787..14101 | - | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
QCG46_RS00060 (14385) | 14385..15521 | - | 1137 | WP_000018695.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
QCG46_RS00065 (15606) | 15606..16109 | + | 504 | WP_001333820.1 | M48 family metallopeptidase | - |
QCG46_RS00070 (16186) | 16186..16878 | + | 693 | WP_000942548.1 | vancomycin high temperature exclusion protein | - |
QCG46_RS00075 (16957) | 16957..17943 | + | 987 | WP_000617698.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T276625 WP_000550189.1 NZ_CP122315:c14101-13787 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT276625 WP_000560266.1 NZ_CP122315:c13790-13374 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|