Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4490194..4490948 | Replicon | chromosome |
| Accession | NZ_CP122301 | ||
| Organism | Salmonella enterica strain 27A | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5RFE2 |
| Locus tag | P8R57_RS21810 | Protein ID | WP_000558168.1 |
| Coordinates | 4490194..4490505 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P8R57_RS21815 | Protein ID | WP_001259009.1 |
| Coordinates | 4490502..4490948 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8R57_RS21780 (4485852) | 4485852..4486754 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| P8R57_RS21785 (4486751) | 4486751..4487386 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P8R57_RS21790 (4487383) | 4487383..4488312 | + | 930 | WP_000027736.1 | formate dehydrogenase accessory protein FdhE | - |
| P8R57_RS21795 (4488359) | 4488359..4488649 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| P8R57_RS21800 (4488650) | 4488650..4488961 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| P8R57_RS21805 (4489179) | 4489179..4490108 | + | 930 | WP_001127705.1 | alpha/beta hydrolase | - |
| P8R57_RS21810 (4490194) | 4490194..4490505 | + | 312 | WP_000558168.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| P8R57_RS21815 (4490502) | 4490502..4490948 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| P8R57_RS21820 (4490963) | 4490963..4491904 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| P8R57_RS21825 (4491949) | 4491949..4492386 | - | 438 | WP_000560968.1 | D-aminoacyl-tRNA deacylase | - |
| P8R57_RS21830 (4492383) | 4492383..4493255 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| P8R57_RS21835 (4493249) | 4493249..4493848 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| P8R57_RS21840 (4494039) | 4494039..4494842 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| P8R57_RS21845 (4494876) | 4494876..4495772 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12324.26 Da Isoelectric Point: 9.3143
>T276621 WP_000558168.1 NZ_CP122301:4490194-4490505 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTLTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTLTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT276621 WP_001259009.1 NZ_CP122301:4490502-4490948 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|