Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4488359..4488961 | Replicon | chromosome |
Accession | NZ_CP122301 | ||
Organism | Salmonella enterica strain 27A |
Toxin (Protein)
Gene name | higB | Uniprot ID | M7S4R6 |
Locus tag | P8R57_RS21800 | Protein ID | WP_001159635.1 |
Coordinates | 4488650..4488961 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | P8R57_RS21795 | Protein ID | WP_000362050.1 |
Coordinates | 4488359..4488649 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8R57_RS21780 (4485852) | 4485852..4486754 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
P8R57_RS21785 (4486751) | 4486751..4487386 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
P8R57_RS21790 (4487383) | 4487383..4488312 | + | 930 | WP_000027736.1 | formate dehydrogenase accessory protein FdhE | - |
P8R57_RS21795 (4488359) | 4488359..4488649 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
P8R57_RS21800 (4488650) | 4488650..4488961 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
P8R57_RS21805 (4489179) | 4489179..4490108 | + | 930 | WP_001127705.1 | alpha/beta hydrolase | - |
P8R57_RS21810 (4490194) | 4490194..4490505 | + | 312 | WP_000558168.1 | type II toxin-antitoxin system HigB family toxin | - |
P8R57_RS21815 (4490502) | 4490502..4490948 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | - |
P8R57_RS21820 (4490963) | 4490963..4491904 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
P8R57_RS21825 (4491949) | 4491949..4492386 | - | 438 | WP_000560968.1 | D-aminoacyl-tRNA deacylase | - |
P8R57_RS21830 (4492383) | 4492383..4493255 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
P8R57_RS21835 (4493249) | 4493249..4493848 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12340.30 Da Isoelectric Point: 9.4460
>T276620 WP_001159635.1 NZ_CP122301:c4488961-4488650 [Salmonella enterica]
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|