Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-SR6/- |
Location | 2134871..2135355 | Replicon | chromosome |
Accession | NZ_CP121861 | ||
Organism | Bacillus stercoris strain Mal05 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | - |
Locus tag | QA442_RS11315 | Protein ID | WP_279474464.1 |
Coordinates | 2135104..2135355 (+) | Length | 84 a.a. |
Antitoxin (RNA)
Gene name | SR6 | ||
Locus tag | - | ||
Coordinates | 2134871..2134968 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA442_RS11295 (2129873) | 2129873..2130151 | - | 279 | WP_279474460.1 | HU-related DNA-binding protein HupN | - |
QA442_RS11300 (2130396) | 2130396..2132915 | - | 2520 | WP_279474461.1 | DNA-directed RNA polymerase YonO | - |
QA442_RS11305 (2132960) | 2132960..2133139 | - | 180 | WP_064814709.1 | hypothetical protein | - |
- (2134871) | 2134871..2134968 | - | 98 | NuclAT_0 | - | Antitoxin |
- (2134871) | 2134871..2134968 | - | 98 | NuclAT_0 | - | Antitoxin |
- (2134871) | 2134871..2134968 | - | 98 | NuclAT_0 | - | Antitoxin |
- (2134871) | 2134871..2134968 | - | 98 | NuclAT_0 | - | Antitoxin |
QA442_RS11310 (2134909) | 2134909..2135085 | + | 177 | WP_071579314.1 | hypothetical protein | - |
QA442_RS11315 (2135104) | 2135104..2135355 | + | 252 | WP_279474464.1 | hypothetical protein | Toxin |
QA442_RS11320 (2135400) | 2135400..2135558 | + | 159 | WP_243572767.1 | hypothetical protein | - |
QA442_RS11325 (2135646) | 2135646..2136863 | + | 1218 | WP_279474466.1 | hypothetical protein | - |
QA442_RS11330 (2137191) | 2137191..2139059 | + | 1869 | WP_279474467.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2071712..2209201 | 137489 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 10024.07 Da Isoelectric Point: 10.2450
>T276594 WP_279474464.1 NZ_CP121861:2135104-2135355 [Bacillus stercoris]
MNFSFSSYPYYNMIKHIVNMKRFSLWFTHITFIGLFLMFQLIKDYFSSEGQTLITTIFVVTCIIAILLWIIYFAFLKLRT
KSR
MNFSFSSYPYYNMIKHIVNMKRFSLWFTHITFIGLFLMFQLIKDYFSSEGQTLITTIFVVTCIIAILLWIIYFAFLKLRT
KSR
Download Length: 252 bp
Antitoxin
Download Length: 98 bp
>AT276594 NZ_CP121861:c2134968-2134871 [Bacillus stercoris]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTATGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATA
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTATGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|