Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | yonT-SR6/- |
| Location | 2134871..2135085 | Replicon | chromosome |
| Accession | NZ_CP121861 | ||
| Organism | Bacillus stercoris strain Mal05 | ||
Toxin (Protein)
| Gene name | yonT | Uniprot ID | - |
| Locus tag | QA442_RS11310 | Protein ID | WP_071579314.1 |
| Coordinates | 2134909..2135085 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SR6 | ||
| Locus tag | - | ||
| Coordinates | 2134871..2134968 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA442_RS11295 (2129873) | 2129873..2130151 | - | 279 | WP_279474460.1 | HU-related DNA-binding protein HupN | - |
| QA442_RS11300 (2130396) | 2130396..2132915 | - | 2520 | WP_279474461.1 | DNA-directed RNA polymerase YonO | - |
| QA442_RS11305 (2132960) | 2132960..2133139 | - | 180 | WP_064814709.1 | hypothetical protein | - |
| - (2134871) | 2134871..2134968 | - | 98 | NuclAT_0 | - | Antitoxin |
| - (2134871) | 2134871..2134968 | - | 98 | NuclAT_0 | - | Antitoxin |
| - (2134871) | 2134871..2134968 | - | 98 | NuclAT_0 | - | Antitoxin |
| - (2134871) | 2134871..2134968 | - | 98 | NuclAT_0 | - | Antitoxin |
| QA442_RS11310 (2134909) | 2134909..2135085 | + | 177 | WP_071579314.1 | hypothetical protein | Toxin |
| QA442_RS11315 (2135104) | 2135104..2135355 | + | 252 | WP_279474464.1 | hypothetical protein | - |
| QA442_RS11320 (2135400) | 2135400..2135558 | + | 159 | WP_243572767.1 | hypothetical protein | - |
| QA442_RS11325 (2135646) | 2135646..2136863 | + | 1218 | WP_279474466.1 | hypothetical protein | - |
| QA442_RS11330 (2137191) | 2137191..2139059 | + | 1869 | WP_279474467.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2071712..2209201 | 137489 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6878.49 Da Isoelectric Point: 12.8849
>T276590 WP_071579314.1 NZ_CP121861:2134909-2135085 [Bacillus stercoris]
VLEKVGIIVAFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRKRIRR
VLEKVGIIVAFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRKRIRR
Download Length: 177 bp
Antitoxin
Download Length: 98 bp
>AT276590 NZ_CP121861:c2134968-2134871 [Bacillus stercoris]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTATGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATA
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTATGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|