Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1501589..1502150 | Replicon | chromosome |
| Accession | NZ_CP121769 | ||
| Organism | Glaesserella parasuis strain Z44 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U4SMA9 |
| Locus tag | QBL01_RS07720 | Protein ID | WP_010786777.1 |
| Coordinates | 1501589..1501867 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | - |
| Locus tag | QBL01_RS07725 | Protein ID | WP_005712616.1 |
| Coordinates | 1501878..1502150 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBL01_RS07700 (QBL01_07700) | 1497441..1498703 | - | 1263 | WP_021113526.1 | serine hydroxymethyltransferase | - |
| QBL01_RS07705 (QBL01_07705) | 1499048..1499644 | + | 597 | WP_279378339.1 | hypothetical protein | - |
| QBL01_RS07710 (QBL01_07710) | 1499735..1500076 | + | 342 | WP_043895690.1 | hypothetical protein | - |
| QBL01_RS07715 (QBL01_07715) | 1500430..1501440 | - | 1011 | WP_279378340.1 | ornithine carbamoyltransferase | - |
| QBL01_RS07720 (QBL01_07720) | 1501589..1501867 | + | 279 | WP_010786777.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QBL01_RS07725 (QBL01_07725) | 1501878..1502150 | + | 273 | WP_005712616.1 | HigA family addiction module antitoxin | Antitoxin |
| QBL01_RS07730 (QBL01_07730) | 1502214..1503434 | + | 1221 | WP_026916465.1 | ATP-dependent RNA helicase RhlB | - |
| QBL01_RS07735 (QBL01_07735) | 1503444..1504931 | + | 1488 | WP_279378341.1 | DUF853 family protein | - |
| QBL01_RS07740 (QBL01_07740) | 1505084..1505626 | - | 543 | WP_279378342.1 | single-stranded DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10278.66 Da Isoelectric Point: 10.0505
>T276568 WP_010786777.1 NZ_CP121769:1501589-1501867 [Glaesserella parasuis]
MIISFKHKGLKLFFETGSTAGIQANHASKLAFQLATLNQAKSALDMNAPSWNLHQLQGNLAGHWSIKVSGNWRLTFKVQN
GHAEVVDYQDYH
MIISFKHKGLKLFFETGSTAGIQANHASKLAFQLATLNQAKSALDMNAPSWNLHQLQGNLAGHWSIKVSGNWRLTFKVQN
GHAEVVDYQDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|