Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 1208554..1209197 | Replicon | chromosome |
| Accession | NZ_CP121769 | ||
| Organism | Glaesserella parasuis strain Z44 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U4SMB1 |
| Locus tag | QBL01_RS05985 | Protein ID | WP_005714197.1 |
| Coordinates | 1208554..1208898 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QBL01_RS05990 | Protein ID | WP_075604521.1 |
| Coordinates | 1208901..1209197 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBL01_RS05970 (QBL01_05970) | 1204379..1204975 | + | 597 | WP_021110885.1 | DedA family protein | - |
| QBL01_RS05975 (QBL01_05975) | 1205158..1206249 | - | 1092 | WP_005714201.1 | murein transglycosylase A | - |
| QBL01_RS05980 (QBL01_05980) | 1206360..1208339 | - | 1980 | WP_075604520.1 | exoribonuclease II | - |
| QBL01_RS05985 (QBL01_05985) | 1208554..1208898 | + | 345 | WP_005714197.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QBL01_RS05990 (QBL01_05990) | 1208901..1209197 | + | 297 | WP_075604521.1 | NadS family protein | Antitoxin |
| QBL01_RS05995 (QBL01_05995) | 1209260..1210222 | + | 963 | WP_075604522.1 | WYL domain-containing protein | - |
| QBL01_RS06000 (QBL01_06000) | 1210331..1211524 | + | 1194 | WP_075604523.1 | PD-(D/E)XK nuclease family protein | - |
| QBL01_RS06005 (QBL01_06005) | 1211613..1212119 | - | 507 | WP_075604524.1 | opioid growth factor receptor-related protein | - |
| QBL01_RS06010 (QBL01_06010) | 1212355..1213098 | + | 744 | WP_075604525.1 | protein phosphatase 2C domain-containing protein | - |
| QBL01_RS06015 (QBL01_06015) | 1213109..1213819 | + | 711 | WP_075604526.1 | NAD-dependent protein deacylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13263.22 Da Isoelectric Point: 5.9233
>T276566 WP_005714197.1 NZ_CP121769:1208554-1208898 [Glaesserella parasuis]
METEEYLTFIETKVFEEDRKALMSDDEYQKFQAYLLESHELGDFIQNTGGCQKIRWKLESNNKGKSGGVRVIYYVVTKQG
KLLLMMMYAKSKQDNMSDKQKAMLKAVVSQLSEE
METEEYLTFIETKVFEEDRKALMSDDEYQKFQAYLLESHELGDFIQNTGGCQKIRWKLESNNKGKSGGVRVIYYVVTKQG
KLLLMMMYAKSKQDNMSDKQKAMLKAVVSQLSEE
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|