Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 1222845..1223488 | Replicon | chromosome |
| Accession | NZ_CP121768 | ||
| Organism | Glaesserella parasuis strain d76 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U4SMB1 |
| Locus tag | QBK97_RS05930 | Protein ID | WP_005714197.1 |
| Coordinates | 1223144..1223488 (-) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QBK97_RS05925 | Protein ID | WP_016527809.1 |
| Coordinates | 1222845..1223141 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBK97_RS05900 (QBK97_05900) | 1217996..1218835 | - | 840 | WP_279368202.1 | Sir2 family NAD-dependent protein deacetylase | - |
| QBK97_RS05905 (QBK97_05905) | 1218862..1219698 | - | 837 | WP_075630450.1 | Sir2 family NAD-dependent protein deacetylase | - |
| QBK97_RS05910 (QBK97_05910) | 1219775..1220485 | - | 711 | WP_021112440.1 | NAD-dependent protein deacylase | - |
| QBK97_RS05915 (QBK97_05915) | 1220496..1221239 | - | 744 | WP_278049264.1 | protein phosphatase 2C domain-containing protein | - |
| QBK97_RS05920 (QBK97_05920) | 1221820..1222782 | - | 963 | WP_021112452.1 | WYL domain-containing protein | - |
| QBK97_RS05925 (QBK97_05925) | 1222845..1223141 | - | 297 | WP_016527809.1 | NadS family protein | Antitoxin |
| QBK97_RS05930 (QBK97_05930) | 1223144..1223488 | - | 345 | WP_005714197.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QBK97_RS05935 (QBK97_05935) | 1223703..1225682 | + | 1980 | WP_160413905.1 | exoribonuclease II | - |
| QBK97_RS05940 (QBK97_05940) | 1225792..1226883 | + | 1092 | WP_005714201.1 | murein transglycosylase A | - |
| QBK97_RS05945 (QBK97_05945) | 1227066..1227662 | - | 597 | WP_021110885.1 | DedA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1205769..1225682 | 19913 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13263.22 Da Isoelectric Point: 5.9233
>T276561 WP_005714197.1 NZ_CP121768:c1223488-1223144 [Glaesserella parasuis]
METEEYLTFIETKVFEEDRKALMSDDEYQKFQAYLLESHELGDFIQNTGGCQKIRWKLESNNKGKSGGVRVIYYVVTKQG
KLLLMMMYAKSKQDNMSDKQKAMLKAVVSQLSEE
METEEYLTFIETKVFEEDRKALMSDDEYQKFQAYLLESHELGDFIQNTGGCQKIRWKLESNNKGKSGGVRVIYYVVTKQG
KLLLMMMYAKSKQDNMSDKQKAMLKAVVSQLSEE
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|