Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1061733..1062294 | Replicon | chromosome |
| Accession | NZ_CP121768 | ||
| Organism | Glaesserella parasuis strain d76 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A143CE91 |
| Locus tag | QBK97_RS05175 | Protein ID | WP_005712614.1 |
| Coordinates | 1062016..1062294 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | - |
| Locus tag | QBK97_RS05170 | Protein ID | WP_005712616.1 |
| Coordinates | 1061733..1062005 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBK97_RS05155 (QBK97_05155) | 1058256..1058798 | + | 543 | WP_021115958.1 | single-stranded DNA-binding protein | - |
| QBK97_RS05160 (QBK97_05160) | 1058952..1060439 | - | 1488 | WP_075631110.1 | DUF853 domain-containing protein | - |
| QBK97_RS05165 (QBK97_05165) | 1060449..1061669 | - | 1221 | WP_075631111.1 | ATP-dependent RNA helicase RhlB | - |
| QBK97_RS05170 (QBK97_05170) | 1061733..1062005 | - | 273 | WP_005712616.1 | HigA family addiction module antitoxin | Antitoxin |
| QBK97_RS05175 (QBK97_05175) | 1062016..1062294 | - | 279 | WP_005712614.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QBK97_RS05180 (QBK97_05180) | 1062443..1063453 | + | 1011 | WP_021115969.1 | ornithine carbamoyltransferase | - |
| QBK97_RS05185 (QBK97_05185) | 1063792..1067121 | - | 3330 | WP_279368321.1 | ESPR-type extended signal peptide-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10326.71 Da Isoelectric Point: 10.0505
>T276560 WP_005712614.1 NZ_CP121768:c1062294-1062016 [Glaesserella parasuis]
MIISFKHKGLKLFFETGSTAGIQANHASKLAFQLATLNQAKSALDMNAPSWNLHQLQGNLAGHWSIKVSGNWRLTFKFQN
GHAEVVDYQDYH
MIISFKHKGLKLFFETGSTAGIQANHASKLAFQLATLNQAKSALDMNAPSWNLHQLQGNLAGHWSIKVSGNWRLTFKFQN
GHAEVVDYQDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|