Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
| Location | 482068..482718 | Replicon | chromosome |
| Accession | NZ_CP121768 | ||
| Organism | Glaesserella parasuis strain d76 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | QBK97_RS02535 | Protein ID | WP_062923967.1 |
| Coordinates | 482380..482718 (-) | Length | 113 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QBK97_RS02530 | Protein ID | WP_005710405.1 |
| Coordinates | 482068..482376 (-) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBK97_RS02510 (QBK97_02510) | 478542..479030 | - | 489 | WP_035496521.1 | transcription elongation factor GreB | - |
| QBK97_RS02515 (QBK97_02515) | 479030..479965 | - | 936 | WP_005710401.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| QBK97_RS02520 (QBK97_02520) | 480026..480607 | - | 582 | WP_035496524.1 | type IV pilus biogenesis/stability protein PilW | - |
| QBK97_RS02525 (QBK97_02525) | 480707..481867 | - | 1161 | WP_010786053.1 | bifunctional tRNA (adenosine(37)-C2)-methyltransferase TrmG/ribosomal RNA large subunit methyltransferase RlmN | - |
| QBK97_RS02530 (QBK97_02530) | 482068..482376 | - | 309 | WP_005710405.1 | helix-turn-helix domain-containing protein | Antitoxin |
| QBK97_RS02535 (QBK97_02535) | 482380..482718 | - | 339 | WP_062923967.1 | toxin | Toxin |
| QBK97_RS02560 (QBK97_02560) | 483557..484996 | + | 1440 | WP_035496906.1 | glutamate--tRNA ligase | - |
| QBK97_RS02570 (QBK97_02570) | 485463..485729 | - | 267 | Protein_478 | cation-transporting ATPase PacS | - |
| QBK97_RS02575 (QBK97_02575) | 485684..486605 | - | 922 | Protein_479 | IS256 family transposase | - |
| QBK97_RS02580 (QBK97_02580) | 486726..487100 | - | 375 | WP_035496549.1 | cytochrome b562 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 486066..486605 | 539 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 13244.26 Da Isoelectric Point: 9.8649
>T276557 WP_062923967.1 NZ_CP121768:c482718-482380 [Glaesserella parasuis]
MNVAFVELPPFEEYRKKYLDDDTFRLLQNELLKFPDKGELIQGTGGLRKLRIVDIIRQKGKRGGARVIYYYYVQGKQVWL
FHAYNKNQQDDLSNEERVVLANTLSYLKSLVR
MNVAFVELPPFEEYRKKYLDDDTFRLLQNELLKFPDKGELIQGTGGLRKLRIVDIIRQKGKRGGARVIYYYYVQGKQVWL
FHAYNKNQQDDLSNEERVVLANTLSYLKSLVR
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|