Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5173082..5173677 | Replicon | chromosome |
Accession | NZ_CP121766 | ||
Organism | Pseudomonas aeruginosa strain 22112 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A6N0KDU0 |
Locus tag | QAY87_RS24420 | Protein ID | WP_023436306.1 |
Coordinates | 5173399..5173677 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QAY87_RS24415 | Protein ID | WP_003133769.1 |
Coordinates | 5173082..5173387 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QAY87_RS24400 (QAY87_24395) | 5169793..5170656 | - | 864 | WP_023098850.1 | integrase domain-containing protein | - |
QAY87_RS24405 (QAY87_24400) | 5171257..5172399 | - | 1143 | WP_023098851.1 | STY4528 family pathogenicity island replication protein | - |
QAY87_RS24415 (QAY87_24410) | 5173082..5173387 | - | 306 | WP_003133769.1 | HigA family addiction module antitoxin | Antitoxin |
QAY87_RS24420 (QAY87_24415) | 5173399..5173677 | - | 279 | WP_023436306.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QAY87_RS24425 (QAY87_24420) | 5173730..5173858 | - | 129 | Protein_4824 | integrase | - |
QAY87_RS24430 (QAY87_24425) | 5174006..5176234 | + | 2229 | WP_023107900.1 | TonB-dependent receptor | - |
QAY87_RS24435 (QAY87_24430) | 5176304..5176951 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
QAY87_RS24440 (QAY87_24435) | 5177013..5178251 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10588.11 Da Isoelectric Point: 7.2451
>T276552 WP_023436306.1 NZ_CP121766:c5173677-5173399 [Pseudomonas aeruginosa]
MILTFRCDEARQLFETGLSRQWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDEARQLFETGLSRQWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|