Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 81483..82150 | Replicon | plasmid p1-WH99 |
| Accession | NZ_CP121764 | ||
| Organism | Prescottella equi strain WH99 | ||
Toxin (Protein)
| Gene name | HigB2 | Uniprot ID | - |
| Locus tag | P9990_RS25380 | Protein ID | WP_286462360.1 |
| Coordinates | 81483..81839 (+) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | HigA2 | Uniprot ID | - |
| Locus tag | P9990_RS25385 | Protein ID | WP_231814663.1 |
| Coordinates | 81845..82150 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P9990_RS25340 (P9990_25340) | 77948..78079 | + | 132 | WP_286462349.1 | helix-turn-helix domain-containing protein | - |
| P9990_RS25345 (P9990_25345) | 78103..78750 | + | 648 | WP_286462350.1 | hypothetical protein | - |
| P9990_RS25350 (P9990_25350) | 78850..79158 | + | 309 | WP_286462351.1 | hypothetical protein | - |
| P9990_RS25355 (P9990_25355) | 79363..79695 | + | 333 | WP_286462353.1 | hypothetical protein | - |
| P9990_RS25360 (P9990_25360) | 79692..79871 | + | 180 | WP_286462354.1 | hypothetical protein | - |
| P9990_RS25365 (P9990_25365) | 79960..80331 | + | 372 | WP_286462355.1 | helix-turn-helix transcriptional regulator | - |
| P9990_RS25370 (P9990_25370) | 80495..80788 | + | 294 | WP_286462356.1 | hypothetical protein | - |
| P9990_RS25375 (P9990_25375) | 80890..81417 | + | 528 | WP_286462359.1 | DnaB-like helicase N-terminal domain-containing protein | - |
| P9990_RS25380 (P9990_25380) | 81483..81839 | + | 357 | WP_286462360.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P9990_RS25385 (P9990_25385) | 81845..82150 | + | 306 | WP_231814663.1 | XRE family transcriptional regulator | Antitoxin |
| P9990_RS25390 (P9990_25390) | 82303..82851 | - | 549 | WP_286462362.1 | DUF6226 family protein | - |
| P9990_RS25395 (P9990_25395) | 83069..83383 | + | 315 | Protein_92 | hypothetical protein | - |
| P9990_RS25400 (P9990_25400) | 83621..83962 | - | 342 | WP_286462363.1 | hypothetical protein | - |
| P9990_RS25405 (P9990_25405) | 84046..84222 | - | 177 | WP_286462505.1 | hypothetical protein | - |
| P9990_RS25410 (P9990_25410) | 84807..85280 | - | 474 | WP_286462364.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | erm(46) | - | 1..431692 | 431692 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13717.53 Da Isoelectric Point: 4.8382
>T276546 WP_286462360.1 NZ_CP121764:81483-81839 [Prescottella equi]
VTNWDVDLELIEDWLTELDQESYEQVVAALELLQERGPQLGRPLVDTIKASRHKNMKELRPGSSGRSELRVLFAFDPERK
AIFLVAGDKAGRWEKWYKVNIPIADDRFDDHLRQLEGK
VTNWDVDLELIEDWLTELDQESYEQVVAALELLQERGPQLGRPLVDTIKASRHKNMKELRPGSSGRSELRVLFAFDPERK
AIFLVAGDKAGRWEKWYKVNIPIADDRFDDHLRQLEGK
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|