Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-YefM |
| Location | 5635918..5636508 | Replicon | chromosome |
| Accession | NZ_CP121700 | ||
| Organism | Methylobacterium indicum strain JDJ13 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | - |
| Locus tag | QBE04_RS26145 | Protein ID | WP_279357320.1 |
| Coordinates | 5636197..5636508 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | A0A0J6ULD8 |
| Locus tag | QBE04_RS26140 | Protein ID | WP_048430593.1 |
| Coordinates | 5635918..5636181 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBE04_RS26135 | 5633098..5635617 | + | 2520 | WP_279357319.1 | glycogen/starch/alpha-glucan phosphorylase | - |
| QBE04_RS26140 | 5635918..5636181 | + | 264 | WP_048430593.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| QBE04_RS26145 | 5636197..5636508 | + | 312 | WP_279357320.1 | Txe/YoeB family addiction module toxin | Toxin |
| QBE04_RS26150 | 5636631..5638190 | - | 1560 | WP_279357321.1 | glucan biosynthesis protein D | - |
| QBE04_RS26155 | 5638204..5638383 | - | 180 | WP_048430596.1 | hypothetical protein | - |
| QBE04_RS26160 | 5638647..5640245 | + | 1599 | WP_279357322.1 | gamma-glutamyltransferase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11965.39 Da Isoelectric Point: 7.8825
>T276545 WP_279357320.1 NZ_CP121700:5636197-5636508 [Methylobacterium indicum]
MTLTFSDDAWSDYVFWQGENTATLERINALIKEIKRTPFTGTGKPEPLKFKLKGWWSRRISGEHRLVYRVSGSGSTHTLE
IAQCRWHYDDESDSRSPCNREAL
MTLTFSDDAWSDYVFWQGENTATLERINALIKEIKRTPFTGTGKPEPLKFKLKGWWSRRISGEHRLVYRVSGSGSTHTLE
IAQCRWHYDDESDSRSPCNREAL
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|