Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4129509..4130157 | Replicon | chromosome |
| Accession | NZ_CP121700 | ||
| Organism | Methylobacterium indicum strain JDJ13 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | QBE04_RS19030 | Protein ID | WP_279356470.1 |
| Coordinates | 4129509..4129790 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A0J6RZH8 |
| Locus tag | QBE04_RS19035 | Protein ID | WP_048431112.1 |
| Coordinates | 4129837..4130157 (+) | Length | 107 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBE04_RS19000 | 4124619..4125053 | + | 435 | WP_279356466.1 | CU044_2847 family protein | - |
| QBE04_RS19005 | 4125196..4126506 | + | 1311 | WP_279356467.1 | adenylosuccinate lyase | - |
| QBE04_RS19010 | 4126727..4127056 | + | 330 | WP_048431117.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QBE04_RS19015 | 4127046..4127327 | + | 282 | WP_048431116.1 | XRE family transcriptional regulator | - |
| QBE04_RS19020 | 4127338..4128264 | - | 927 | WP_279356468.1 | dihydrodipicolinate synthase family protein | - |
| QBE04_RS19025 | 4128462..4129313 | + | 852 | WP_279356469.1 | D-amino-acid transaminase | - |
| QBE04_RS19030 | 4129509..4129790 | + | 282 | WP_279356470.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QBE04_RS19035 | 4129837..4130157 | + | 321 | WP_048431112.1 | HigA family addiction module antitoxin | Antitoxin |
| QBE04_RS19040 | 4130225..4130587 | + | 363 | WP_048431111.1 | hypothetical protein | - |
| QBE04_RS19045 | 4130749..4132041 | + | 1293 | WP_279356471.1 | adenylosuccinate synthase | - |
| QBE04_RS19050 | 4132115..4133449 | + | 1335 | WP_279356472.1 | histidine kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10696.25 Da Isoelectric Point: 9.7576
>T276542 WP_279356470.1 NZ_CP121700:4129509-4129790 [Methylobacterium indicum]
VIRSFADERTRHVFEGRHPKGIPADILKTARRKLDYLDAATSLDALKVPPGNKLHPLLRARAGQHAIRINDQFRVCFRWT
EIGPEDVEIVDYH
VIRSFADERTRHVFEGRHPKGIPADILKTARRKLDYLDAATSLDALKVPPGNKLHPLLRARAGQHAIRINDQFRVCFRWT
EIGPEDVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|