Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 4437102..4437802 | Replicon | chromosome |
| Accession | NZ_CP121682 | ||
| Organism | Streptomyces sp. HUAS 5 | ||
Toxin (Protein)
| Gene name | HigB2 | Uniprot ID | - |
| Locus tag | PYS65_RS20345 | Protein ID | WP_279335353.1 |
| Coordinates | 4437404..4437802 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | HigA2 | Uniprot ID | - |
| Locus tag | PYS65_RS20340 | Protein ID | WP_279335352.1 |
| Coordinates | 4437102..4437392 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYS65_RS20320 (PYS65_20320) | 4432267..4433388 | + | 1122 | WP_279335348.1 | peptidoglycan bridge formation glycyltransferase FemA/FemB family protein | - |
| PYS65_RS20325 (PYS65_20325) | 4433720..4435303 | - | 1584 | WP_279335349.1 | von Willebrand factor type A domain-containing protein | - |
| PYS65_RS20330 (PYS65_20330) | 4435678..4436646 | + | 969 | WP_279335350.1 | EamA family transporter | - |
| PYS65_RS20335 (PYS65_20335) | 4436693..4437052 | + | 360 | WP_279335351.1 | DUF6247 family protein | - |
| PYS65_RS20340 (PYS65_20340) | 4437102..4437392 | - | 291 | WP_279335352.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| PYS65_RS20345 (PYS65_20345) | 4437404..4437802 | - | 399 | WP_279335353.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PYS65_RS20350 (PYS65_20350) | 4437940..4438737 | + | 798 | WP_279335354.1 | TIGR03084 family metal-binding protein | - |
| PYS65_RS20355 (PYS65_20355) | 4438734..4440434 | + | 1701 | WP_279335355.1 | DUF1446 domain-containing protein | - |
| PYS65_RS20360 (PYS65_20360) | 4440431..4442029 | + | 1599 | WP_279335356.1 | carboxyl transferase domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15167.36 Da Isoelectric Point: 9.7528
>T276531 WP_279335353.1 NZ_CP121682:c4437802-4437404 [Streptomyces sp. HUAS 5]
VAEPYELRFFDDVLNWIKTLAKEDPDSHLHVIAALERLQEVGPALRRPTVGAIEKSRYRNMRELRPRNGGAVSIRMLFVF
DPERRAIFLVAGNKAAGRQWAAWYPRAVKEADDKFTAYLEALEQEKKKGQGE
VAEPYELRFFDDVLNWIKTLAKEDPDSHLHVIAALERLQEVGPALRRPTVGAIEKSRYRNMRELRPRNGGAVSIRMLFVF
DPERRAIFLVAGNKAAGRQWAAWYPRAVKEADDKFTAYLEALEQEKKKGQGE
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|