Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1984772..1985354 | Replicon | chromosome |
Accession | NZ_CP121679 | ||
Organism | Ancylobacter sp. WKF20 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | AncyloWKF20_RS09220 | Protein ID | WP_279317558.1 |
Coordinates | 1985073..1985354 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | AncyloWKF20_RS09215 | Protein ID | WP_279317557.1 |
Coordinates | 1984772..1985062 (-) | Length | 97 a.a. |
Genomic Context
Location: 1980617..1981072 (456 bp)
Type: Others
Protein ID: WP_279317553.1
Type: Others
Protein ID: WP_279317553.1
Location: 1982903..1984765 (1863 bp)
Type: Others
Protein ID: WP_279317556.1
Type: Others
Protein ID: WP_279317556.1
Location: 1988498..1989508 (1011 bp)
Type: Others
Protein ID: WP_279317562.1
Type: Others
Protein ID: WP_279317562.1
Location: 1981080..1982012 (933 bp)
Type: Others
Protein ID: WP_279317554.1
Type: Others
Protein ID: WP_279317554.1
Location: 1982076..1982771 (696 bp)
Type: Others
Protein ID: WP_279317555.1
Type: Others
Protein ID: WP_279317555.1
Location: 1984772..1985062 (291 bp)
Type: Antitoxin
Protein ID: WP_279317557.1
Type: Antitoxin
Protein ID: WP_279317557.1
Location: 1985073..1985354 (282 bp)
Type: Toxin
Protein ID: WP_279317558.1
Type: Toxin
Protein ID: WP_279317558.1
Location: 1985415..1986626 (1212 bp)
Type: Others
Protein ID: WP_279317559.1
Type: Others
Protein ID: WP_279317559.1
Location: 1986623..1986883 (261 bp)
Type: Others
Protein ID: WP_279317560.1
Type: Others
Protein ID: WP_279317560.1
Location: 1986883..1987551 (669 bp)
Type: Others
Protein ID: WP_279317920.1
Type: Others
Protein ID: WP_279317920.1
Location: 1987581..1988237 (657 bp)
Type: Others
Protein ID: WP_279317561.1
Type: Others
Protein ID: WP_279317561.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AncyloWKF20_RS09195 (AncyloWKF20_09195) | 1980617..1981072 | + | 456 | WP_279317553.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
AncyloWKF20_RS09200 (AncyloWKF20_09200) | 1981080..1982012 | - | 933 | WP_279317554.1 | oxygen-dependent coproporphyrinogen oxidase | - |
AncyloWKF20_RS09205 (AncyloWKF20_09205) | 1982076..1982771 | - | 696 | WP_279317555.1 | VIT family protein | - |
AncyloWKF20_RS09210 (AncyloWKF20_09210) | 1982903..1984765 | + | 1863 | WP_279317556.1 | ABC transporter ATP-binding protein | - |
AncyloWKF20_RS09215 (AncyloWKF20_09215) | 1984772..1985062 | - | 291 | WP_279317557.1 | HigA family addiction module antitoxin | Antitoxin |
AncyloWKF20_RS09220 (AncyloWKF20_09220) | 1985073..1985354 | - | 282 | WP_279317558.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
AncyloWKF20_RS09225 (AncyloWKF20_09225) | 1985415..1986626 | - | 1212 | WP_279317559.1 | CCA tRNA nucleotidyltransferase | - |
AncyloWKF20_RS09230 (AncyloWKF20_09230) | 1986623..1986883 | - | 261 | WP_279317560.1 | DUF6111 family protein | - |
AncyloWKF20_RS09235 (AncyloWKF20_09235) | 1986883..1987551 | - | 669 | WP_279317920.1 | CoA pyrophosphatase | - |
AncyloWKF20_RS09240 (AncyloWKF20_09240) | 1987581..1988237 | - | 657 | WP_279317561.1 | DUF1285 domain-containing protein | - |
AncyloWKF20_RS09245 (AncyloWKF20_09245) | 1988498..1989508 | + | 1011 | WP_279317562.1 | MoxR family ATPase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10420.00 Da Isoelectric Point: 10.4492
>T276527 WP_279317558.1 NZ_CP121679:c1985354-1985073 [Ancylobacter sp. WKF20]
MILNFRDKRTAAVWAGQVGKGFPADLVRGAQRKLAMIHAAVTLDALRAPPANRLEVLKGDRAGQHSIRINDQFRICFIWR
DGHAADVEITDYH
MILNFRDKRTAAVWAGQVGKGFPADLVRGAQRKLAMIHAAVTLDALRAPPANRLEVLKGDRAGQHSIRINDQFRICFIWR
DGHAADVEITDYH
Download Length: 282 bp