Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 6964485..6965084 | Replicon | chromosome |
Accession | NZ_CP121668 | ||
Organism | Bradyrhizobium sp. CB2312 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | QA642_RS33980 | Protein ID | WP_283080780.1 |
Coordinates | 6964485..6964766 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | QA642_RS33985 | Protein ID | WP_283080781.1 |
Coordinates | 6964779..6965084 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA642_RS33955 (QA642_33955) | 6960561..6961442 | + | 882 | WP_283080776.1 | alpha/beta hydrolase | - |
QA642_RS33960 (QA642_33960) | 6961680..6962624 | + | 945 | WP_283080777.1 | metallophosphoesterase | - |
QA642_RS33965 (QA642_33965) | 6962649..6962987 | + | 339 | WP_235539447.1 | cupredoxin family copper-binding protein | - |
QA642_RS33970 (QA642_33970) | 6963103..6963651 | + | 549 | WP_283080778.1 | sigma-70 family RNA polymerase sigma factor | - |
QA642_RS33975 (QA642_33975) | 6963648..6964415 | + | 768 | WP_283080779.1 | anti-sigma factor | - |
QA642_RS33980 (QA642_33980) | 6964485..6964766 | + | 282 | WP_283080780.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QA642_RS33985 (QA642_33985) | 6964779..6965084 | + | 306 | WP_283080781.1 | HigA family addiction module antitoxin | Antitoxin |
QA642_RS33990 (QA642_33990) | 6965109..6965513 | - | 405 | WP_283080782.1 | GFA family protein | - |
QA642_RS33995 (QA642_33995) | 6965631..6967022 | - | 1392 | WP_283080783.1 | aminobacteriohopanetriol synthase HpnO | - |
QA642_RS34000 (QA642_34000) | 6967163..6967786 | + | 624 | WP_283080784.1 | DUF2147 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10473.92 Da Isoelectric Point: 9.0512
>T276522 WP_283080780.1 NZ_CP121668:6964485-6964766 [Bradyrhizobium sp. CB2312]
VIRTFRDKTTEAVFNGESPKGFPADLVKVARRKLRYLHAAAELGDLRAPPGNRLEALAGDRKGQHSIRINDQFRVCFIWT
AEGPAEVEIVDYH
VIRTFRDKTTEAVFNGESPKGFPADLVKVARRKLRYLHAAAELGDLRAPPGNRLEALAGDRKGQHSIRINDQFRVCFIWT
AEGPAEVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|