Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1705394..1705986 | Replicon | chromosome |
Accession | NZ_CP121652 | ||
Organism | Rhizobium sp. CB3171 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | QA648_RS08385 | Protein ID | WP_104823382.1 |
Coordinates | 1705705..1705986 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | QA648_RS08380 | Protein ID | WP_283050820.1 |
Coordinates | 1705394..1705693 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA648_RS08370 (QA648_08370) | 1701003..1701602 | - | 600 | WP_283050816.1 | dimethylsulfonioproprionate lyase family protein | - |
QA648_RS08375 (QA648_08375) | 1701599..1705369 | - | 3771 | WP_283050818.1 | cobaltochelatase subunit CobN | - |
QA648_RS08380 (QA648_08380) | 1705394..1705693 | - | 300 | WP_283050820.1 | HigA family addiction module antitoxin | Antitoxin |
QA648_RS08385 (QA648_08385) | 1705705..1705986 | - | 282 | WP_104823382.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QA648_RS08390 (QA648_08390) | 1706044..1707093 | - | 1050 | WP_283050823.1 | cobalamin biosynthesis protein CobW | - |
QA648_RS08395 (QA648_08395) | 1707099..1707626 | - | 528 | WP_283050825.1 | bifunctional adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase | - |
QA648_RS08400 (QA648_08400) | 1708349..1710145 | + | 1797 | WP_283050827.1 | chloride channel protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10517.96 Da Isoelectric Point: 8.9312
>T276493 WP_104823382.1 NZ_CP121652:c1705986-1705705 [Rhizobium sp. CB3171]
VIVSYKGKFAEAVASGNVPKGFPADLVRSAQRKLTILNYAVVLDDLRSPPGNRLERLQGDRSGQYSIRINDQWRICFLWT
EAGPRDVEIVDYH
VIVSYKGKFAEAVASGNVPKGFPADLVRSAQRKLTILNYAVVLDDLRSPPGNRLERLQGDRSGQYSIRINDQWRICFLWT
EAGPRDVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|