Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 6045825..6046424 | Replicon | chromosome |
| Accession | NZ_CP121650 | ||
| Organism | Bradyrhizobium sp. CB82 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | - |
| Locus tag | QA640_RS29480 | Protein ID | WP_283036372.1 |
| Coordinates | 6045825..6046106 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | - |
| Locus tag | QA640_RS29485 | Protein ID | WP_283036373.1 |
| Coordinates | 6046119..6046424 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA640_RS29450 (QA640_29450) | 6040938..6042128 | - | 1191 | WP_283036367.1 | efflux RND transporter periplasmic adaptor subunit | - |
| QA640_RS29455 (QA640_29455) | 6042135..6042446 | + | 312 | WP_283036368.1 | hypothetical protein | - |
| QA640_RS29460 (QA640_29460) | 6043055..6043993 | + | 939 | WP_283036369.1 | metallophosphoesterase | - |
| QA640_RS29465 (QA640_29465) | 6044007..6044330 | + | 324 | WP_283036370.1 | cupredoxin family copper-binding protein | - |
| QA640_RS29470 (QA640_29470) | 6044434..6044976 | + | 543 | WP_283042922.1 | sigma-70 family RNA polymerase sigma factor | - |
| QA640_RS29475 (QA640_29475) | 6044982..6045743 | + | 762 | WP_283036371.1 | anti-sigma factor | - |
| QA640_RS29480 (QA640_29480) | 6045825..6046106 | + | 282 | WP_283036372.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QA640_RS29485 (QA640_29485) | 6046119..6046424 | + | 306 | WP_283036373.1 | HigA family addiction module antitoxin | Antitoxin |
| QA640_RS29490 (QA640_29490) | 6046502..6047893 | - | 1392 | WP_283036374.1 | aminobacteriohopanetriol synthase HpnO | - |
| QA640_RS29495 (QA640_29495) | 6048018..6048632 | + | 615 | WP_283036375.1 | DUF2147 domain-containing protein | - |
| QA640_RS29500 (QA640_29500) | 6048600..6051188 | - | 2589 | WP_283036376.1 | MMPL family transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10557.96 Da Isoelectric Point: 9.8495
>T276488 WP_283036372.1 NZ_CP121650:6045825-6046106 [Bradyrhizobium sp. CB82]
VIRTFRDRATEAVFNGEAPKGFPADLVKVARRKLRYLHAADNLSDLRSPPGNRLEALAGNRRGQHSIRINDQFRICFVWT
AEGPAEVEIVDYH
VIRTFRDRATEAVFNGEAPKGFPADLVKVARRKLRYLHAADNLSDLRSPPGNRLEALAGNRRGQHSIRINDQFRICFVWT
AEGPAEVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|