Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 6815244..6815830 | Replicon | chromosome |
Accession | NZ_CP121648 | ||
Organism | Methylobacterium nodulans strain CB376 |
Toxin (Protein)
Gene name | higB | Uniprot ID | B0UR34 |
Locus tag | QA634_RS31415 | Protein ID | WP_012335864.1 |
Coordinates | 6815549..6815830 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QA634_RS31410 | Protein ID | WP_018263550.1 |
Coordinates | 6815244..6815534 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA634_RS31390 (QA634_31390) | 6810512..6811036 | + | 525 | WP_012335859.1 | histidine phosphatase family protein | - |
QA634_RS31395 (QA634_31395) | 6811305..6812660 | + | 1356 | WP_012335860.1 | hypothetical protein | - |
QA634_RS31400 (QA634_31400) | 6812781..6814226 | + | 1446 | WP_012335861.1 | YcjX family protein | - |
QA634_RS31405 (QA634_31405) | 6814223..6815233 | + | 1011 | WP_012335862.1 | TIGR01620 family protein | - |
QA634_RS31410 (QA634_31410) | 6815244..6815534 | - | 291 | WP_018263550.1 | HigA family addiction module antitoxin | Antitoxin |
QA634_RS31415 (QA634_31415) | 6815549..6815830 | - | 282 | WP_012335864.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QA634_RS31420 (QA634_31420) | 6816064..6817236 | - | 1173 | WP_012335865.1 | 4-hydroxybenzoate 3-monooxygenase | - |
QA634_RS31425 (QA634_31425) | 6817399..6818286 | + | 888 | WP_012335866.1 | helix-turn-helix domain-containing protein | - |
QA634_RS31430 (QA634_31430) | 6818292..6819200 | + | 909 | WP_012335867.1 | aldo/keto reductase | - |
QA634_RS31435 (QA634_31435) | 6819460..6819864 | + | 405 | WP_012335868.1 | hypothetical protein | - |
QA634_RS31440 (QA634_31440) | 6819898..6820389 | - | 492 | WP_012335869.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10783.15 Da Isoelectric Point: 6.3228
>T276487 WP_012335864.1 NZ_CP121648:c6815830-6815549 [Methylobacterium nodulans]
MIQSFADKHARALHEDGICHPRWRAFERIALRKLDALDAAVDLDDLRSPPGNRLEPLQGDRAGQHSIRINDQWRICFRWT
DLGPEEVAIVDYH
MIQSFADKHARALHEDGICHPRWRAFERIALRKLDALDAAVDLDDLRSPPGNRLEPLQGDRAGQHSIRINDQWRICFRWT
DLGPEEVAIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|