Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 7999353..7999966 | Replicon | chromosome |
Accession | NZ_CP121647 | ||
Organism | Bradyrhizobium sp. CB3481 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | QA643_RS38480 | Protein ID | WP_283031124.1 |
Coordinates | 7999670..7999966 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QA643_RS38475 | Protein ID | WP_283031122.1 |
Coordinates | 7999353..7999661 (-) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA643_RS38450 (QA643_38450) | 7994449..7996383 | - | 1935 | WP_283031114.1 | cyclic nucleotide-binding domain-containing protein | - |
QA643_RS38455 (QA643_38455) | 7996532..7997611 | - | 1080 | WP_283031116.1 | LLM class flavin-dependent oxidoreductase | - |
QA643_RS38460 (QA643_38460) | 7997748..7998155 | + | 408 | WP_283031118.1 | YccF domain-containing protein | - |
QA643_RS38465 (QA643_38465) | 7998168..7998641 | - | 474 | WP_283031120.1 | universal stress protein | - |
QA643_RS38475 (QA643_38475) | 7999353..7999661 | - | 309 | WP_283031122.1 | HigA family addiction module antitoxin | Antitoxin |
QA643_RS38480 (QA643_38480) | 7999670..7999966 | - | 297 | WP_283031124.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QA643_RS38485 (QA643_38485) | 8000106..8000636 | + | 531 | WP_283031126.1 | bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase | - |
QA643_RS38490 (QA643_38490) | 8000777..8000983 | - | 207 | WP_283031128.1 | hypothetical protein | - |
QA643_RS38495 (QA643_38495) | 8001502..8002002 | - | 501 | WP_283031130.1 | copper chaperone PCu(A)C | - |
QA643_RS38500 (QA643_38500) | 8002324..8003475 | + | 1152 | WP_283031132.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11749.15 Da Isoelectric Point: 7.4034
>T276486 WP_283031124.1 NZ_CP121647:c7999966-7999670 [Bradyrhizobium sp. CB3481]
MISNFRDDWLRAFFVDDVHSRNVPPDLESRLFRKLQMLDDATTDQDLRVPPSNHFEKLRGKLEGFHSIRVNSQWRLIFRW
DGRRGEASGVYLDDHSYR
MISNFRDDWLRAFFVDDVHSRNVPPDLESRLFRKLQMLDDATTDQDLRVPPSNHFEKLRGKLEGFHSIRVNSQWRLIFRW
DGRRGEASGVYLDDHSYR
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|