Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 3419535..3420143 | Replicon | chromosome |
| Accession | NZ_CP121647 | ||
| Organism | Bradyrhizobium sp. CB3481 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | - |
| Locus tag | QA643_RS16490 | Protein ID | WP_283034825.1 |
| Coordinates | 3419535..3419819 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QA643_RS16495 | Protein ID | WP_283034152.1 |
| Coordinates | 3419832..3420143 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA643_RS16465 (QA643_16465) | 3415410..3416120 | + | 711 | WP_283034147.1 | tetratricopeptide repeat protein | - |
| QA643_RS16470 (QA643_16470) | 3416139..3416972 | - | 834 | WP_283034148.1 | class I SAM-dependent methyltransferase | - |
| QA643_RS16475 (QA643_16475) | 3417118..3417717 | - | 600 | WP_283034149.1 | TetR/AcrR family transcriptional regulator | - |
| QA643_RS16480 (QA643_16480) | 3417887..3418264 | + | 378 | WP_283034150.1 | tautomerase family protein | - |
| QA643_RS16485 (QA643_16485) | 3418413..3419354 | - | 942 | WP_283034151.1 | alpha/beta hydrolase | - |
| QA643_RS16490 (QA643_16490) | 3419535..3419819 | + | 285 | WP_283034825.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QA643_RS16495 (QA643_16495) | 3419832..3420143 | + | 312 | WP_283034152.1 | HigA family addiction module antitoxin | Antitoxin |
| QA643_RS16500 (QA643_16500) | 3420150..3421367 | + | 1218 | WP_283034153.1 | RluA family pseudouridine synthase | - |
| QA643_RS16505 (QA643_16505) | 3421465..3422679 | + | 1215 | WP_283034154.1 | amidohydrolase family protein | - |
| QA643_RS16510 (QA643_16510) | 3422838..3423611 | + | 774 | WP_283034155.1 | ATP12 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10698.08 Da Isoelectric Point: 7.1660
>T276482 WP_283034825.1 NZ_CP121647:3419535-3419819 [Bradyrhizobium sp. CB3481]
MIVSYRDKRTERFASGRHVKEFSGFARQAEMRLDRLDAATSLADLAALPGNRLEALRGDRAGLYSIRINDQWRICFAWPE
GSSGPIEVEIVDYH
MIVSYRDKRTERFASGRHVKEFSGFARQAEMRLDRLDAATSLADLAALPGNRLEALRGDRAGLYSIRINDQWRICFAWPE
GSSGPIEVEIVDYH
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|