Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 34276..34934 Replicon plasmid pIV_JAB144
Accession NZ_CP121627
Organism Acinetobacter baumannii strain JAB144

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag MTS17_RS20160 Protein ID WP_000312250.1
Coordinates 34276..34635 (+) Length 120 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag MTS17_RS20165 Protein ID WP_001096429.1
Coordinates 34635..34934 (+) Length 100 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MTS17_RS20120 (MTS17_20120) 29355..29669 - 315 WP_000708714.1 hypothetical protein -
MTS17_RS20125 (MTS17_20125) 30722..31018 - 297 WP_000253575.1 hypothetical protein -
MTS17_RS20130 (MTS17_20130) 31090..31296 + 207 WP_001027832.1 hypothetical protein -
MTS17_RS20135 (MTS17_20135) 31421..31924 - 504 WP_001053125.1 hypothetical protein -
MTS17_RS20140 (MTS17_20140) 31991..32374 - 384 WP_000654348.1 hypothetical protein -
MTS17_RS20145 (MTS17_20145) 32513..33211 - 699 WP_000873188.1 hypothetical protein -
MTS17_RS20150 (MTS17_20150) 33278..33460 - 183 WP_000373385.1 hypothetical protein -
MTS17_RS20155 (MTS17_20155) 33509..34075 - 567 WP_000710385.1 hypothetical protein -
MTS17_RS20160 (MTS17_20160) 34276..34635 + 360 WP_000312250.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
MTS17_RS20165 (MTS17_20165) 34635..34934 + 300 WP_001096429.1 XRE family transcriptional regulator Antitoxin
MTS17_RS20170 (MTS17_20170) 35472..36008 - 537 WP_000731978.1 hypothetical protein -
MTS17_RS20175 (MTS17_20175) 36058..36612 - 555 WP_000790084.1 hypothetical protein -
MTS17_RS20180 (MTS17_20180) 36632..36850 - 219 WP_001043201.1 hypothetical protein -
MTS17_RS20185 (MTS17_20185) 36890..37519 - 630 WP_000701003.1 hypothetical protein -
MTS17_RS20190 (MTS17_20190) 37536..37715 - 180 WP_000387630.1 hypothetical protein -
MTS17_RS20195 (MTS17_20195) 37691..38056 - 366 WP_079757771.1 hypothetical protein -
MTS17_RS20200 (MTS17_20200) 38267..38524 - 258 WP_000834290.1 hypothetical protein -
MTS17_RS20205 (MTS17_20205) 38629..39909 - 1281 WP_001093570.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(3')-VIa - 1..70541 70541


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(14-109)

Antitoxin

HigA2-like, helix-turn-helix domain

(12-88)


Sequences

Toxin        


Download         Length: 120 a.a.        Molecular weight: 13751.62 Da        Isoelectric Point: 4.8212

>T276457 WP_000312250.1 NZ_CP121627:34276-34635 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK

Download         Length: 360 bp

Antitoxin


Download         Length: 100 a.a.        Molecular weight: 11012.93 Da        Isoelectric Point: 10.4856

>AT276457 WP_001096429.1 NZ_CP121627:34635-34934 [Acinetobacter baumannii]
MAKLNDIISKRSPESQQRIKKMANQMLLDINLSNLREELKISQAEIAKNLGVSQAAISKREKLGKDLKISSLKEYVEAMG
GKVRLDVELPNGKHVAISI

Download         Length: 300 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References