Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 10986..11637 | Replicon | plasmid pIII_JAB186 |
Accession | NZ_CP121611 | ||
Organism | Acinetobacter baumannii strain JAB186 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | MTS34_RS20155 | Protein ID | WP_000269902.1 |
Coordinates | 10986..11342 (+) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | MTS34_RS20160 | Protein ID | WP_001140622.1 |
Coordinates | 11335..11637 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MTS34_RS20130 (MTS34_20130) | 6498..6641 | - | 144 | WP_001125246.1 | hypothetical protein | - |
MTS34_RS20135 (MTS34_20135) | 6661..7236 | - | 576 | WP_001096616.1 | plasmid replication DNA-binding protein | - |
MTS34_RS20140 (MTS34_20140) | 7229..8179 | - | 951 | WP_001205343.1 | replication initiation protein RepM | - |
MTS34_RS20145 (MTS34_20145) | 9315..9506 | + | 192 | WP_000032259.1 | hypothetical protein | - |
MTS34_RS20150 (MTS34_20150) | 9550..10377 | - | 828 | WP_000713530.1 | OXA-24 family carbapenem-hydrolyzing class D beta-lactamase OXA-72 | - |
MTS34_RS20155 (MTS34_20155) | 10986..11342 | + | 357 | WP_000269902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MTS34_RS20160 (MTS34_20160) | 11335..11637 | + | 303 | WP_001140622.1 | XRE family transcriptional regulator | Antitoxin |
MTS34_RS20165 (MTS34_20165) | 11630..11839 | + | 210 | WP_000069473.1 | hypothetical protein | - |
MTS34_RS20170 (MTS34_20170) | 12165..12626 | - | 462 | WP_000761346.1 | DIP1984 family protein | - |
MTS34_RS20175 (MTS34_20175) | 12931..15345 | - | 2415 | Protein_17 | TonB-dependent receptor ZnuD2 | - |
MTS34_RS20180 (MTS34_20180) | 15473..15787 | - | 315 | WP_001983304.1 | BrnA antitoxin family protein | - |
MTS34_RS20185 (MTS34_20185) | 15774..16061 | - | 288 | WP_000438826.1 | BrnT family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | mph(E) / msr(E) / blaOXA-72 | - | 1..21454 | 21454 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13487.44 Da Isoelectric Point: 6.4631
>T276449 WP_000269902.1 NZ_CP121611:10986-11342 [Acinetobacter baumannii]
MWTVITTDLFNEWLAQQDESTQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKGGKKRFYKEMLDIADQQYELHLSTLGDQSNG
MWTVITTDLFNEWLAQQDESTQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKGGKKRFYKEMLDIADQQYELHLSTLGDQSNG
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|