Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 4727..5312 | Replicon | plasmid pIII_JAB186 |
Accession | NZ_CP121611 | ||
Organism | Acinetobacter baumannii strain JAB186 |
Toxin (Protein)
Gene name | higB | Uniprot ID | N9CJF7 |
Locus tag | MTS34_RS20120 | Protein ID | WP_000897307.1 |
Coordinates | 4992..5312 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | MTS34_RS20115 | Protein ID | WP_000369781.1 |
Coordinates | 4727..4999 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MTS34_RS20090 (MTS34_20090) | 154..411 | + | 258 | WP_159516864.1 | hypothetical protein | - |
MTS34_RS20095 (MTS34_20095) | 443..823 | - | 381 | WP_015060210.1 | hypothetical protein | - |
MTS34_RS20100 (MTS34_20100) | 1018..1629 | + | 612 | WP_015060246.1 | recombinase family protein | - |
MTS34_RS20105 (MTS34_20105) | 1819..2703 | - | 885 | WP_000155092.1 | Mph(E) family macrolide 2'-phosphotransferase | - |
MTS34_RS20110 (MTS34_20110) | 2759..4234 | - | 1476 | WP_000052512.1 | ABC-F type ribosomal protection protein Msr(E) | - |
MTS34_RS20115 (MTS34_20115) | 4727..4999 | - | 273 | WP_000369781.1 | NadS family protein | Antitoxin |
MTS34_RS20120 (MTS34_20120) | 4992..5312 | - | 321 | WP_000897307.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MTS34_RS20125 (MTS34_20125) | 5488..6315 | + | 828 | WP_000713530.1 | OXA-24 family carbapenem-hydrolyzing class D beta-lactamase OXA-72 | - |
MTS34_RS20130 (MTS34_20130) | 6498..6641 | - | 144 | WP_001125246.1 | hypothetical protein | - |
MTS34_RS20135 (MTS34_20135) | 6661..7236 | - | 576 | WP_001096616.1 | plasmid replication DNA-binding protein | - |
MTS34_RS20140 (MTS34_20140) | 7229..8179 | - | 951 | WP_001205343.1 | replication initiation protein RepM | - |
MTS34_RS20145 (MTS34_20145) | 9315..9506 | + | 192 | WP_000032259.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | mph(E) / msr(E) / blaOXA-72 | - | 1..21454 | 21454 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12187.95 Da Isoelectric Point: 7.1639
>T276448 WP_000897307.1 NZ_CP121611:c5312-4992 [Acinetobacter baumannii]
MLFIETSIFTKQIKDLVSDEEYRQLQQDLLVQPDRGDLIKNGGGIRKVRCAQGNKGKSGGIRVIYYWVTEDDQIFFLVAY
PKSVKDNLTDKETAILHQLVKEQFHG
MLFIETSIFTKQIKDLVSDEEYRQLQQDLLVQPDRGDLIKNGGGIRKVRCAQGNKGKSGGIRVIYYWVTEDDQIFFLVAY
PKSVKDNLTDKETAILHQLVKEQFHG
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|