Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 26052..26710 | Replicon | plasmid pIV_RAB77 |
| Accession | NZ_CP121599 | ||
| Organism | Acinetobacter baumannii strain JAB77 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | MTS78_RS19625 | Protein ID | WP_000312250.1 |
| Coordinates | 26052..26411 (+) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | MTS78_RS19630 | Protein ID | WP_001096429.1 |
| Coordinates | 26411..26710 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTS78_RS19590 (MTS78_19590) | 21129..21443 | - | 315 | WP_000708714.1 | hypothetical protein | - |
| MTS78_RS19595 (MTS78_19595) | 22498..22794 | - | 297 | WP_000253575.1 | hypothetical protein | - |
| MTS78_RS19600 (MTS78_19600) | 23197..23700 | - | 504 | WP_001053125.1 | hypothetical protein | - |
| MTS78_RS19605 (MTS78_19605) | 23767..24150 | - | 384 | WP_000654348.1 | hypothetical protein | - |
| MTS78_RS19610 (MTS78_19610) | 24289..24987 | - | 699 | WP_000873188.1 | hypothetical protein | - |
| MTS78_RS19615 (MTS78_19615) | 25054..25236 | - | 183 | WP_000373385.1 | hypothetical protein | - |
| MTS78_RS19620 (MTS78_19620) | 25285..25851 | - | 567 | WP_000710385.1 | hypothetical protein | - |
| MTS78_RS19625 (MTS78_19625) | 26052..26411 | + | 360 | WP_000312250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| MTS78_RS19630 (MTS78_19630) | 26411..26710 | + | 300 | WP_001096429.1 | XRE family transcriptional regulator | Antitoxin |
| MTS78_RS19635 (MTS78_19635) | 27248..27784 | - | 537 | WP_000731978.1 | hypothetical protein | - |
| MTS78_RS19640 (MTS78_19640) | 27834..28388 | - | 555 | WP_000790084.1 | hypothetical protein | - |
| MTS78_RS19645 (MTS78_19645) | 28408..28626 | - | 219 | WP_001043201.1 | hypothetical protein | - |
| MTS78_RS19650 (MTS78_19650) | 28666..29295 | - | 630 | WP_000701003.1 | hypothetical protein | - |
| MTS78_RS19655 (MTS78_19655) | 29312..29491 | - | 180 | WP_000387630.1 | hypothetical protein | - |
| MTS78_RS19660 (MTS78_19660) | 29467..29832 | - | 366 | WP_079757771.1 | hypothetical protein | - |
| MTS78_RS19665 (MTS78_19665) | 30067..31035 | - | 969 | WP_005804963.1 | IS30 family transposase | - |
| MTS78_RS19670 (MTS78_19670) | 31130..31390 | - | 261 | WP_283026619.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aph(3')-VIa | - | 1..72243 | 72243 | |
| - | flank | IS/Tn | - | - | 30067..31092 | 1025 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13751.62 Da Isoelectric Point: 4.8212
>T276445 WP_000312250.1 NZ_CP121599:26052-26411 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|