Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 61466..62124 | Replicon | plasmid pIV_MAB17 |
| Accession | NZ_CP121596 | ||
| Organism | Acinetobacter baumannii strain MAB17 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | MTS72_RS19335 | Protein ID | WP_000312250.1 |
| Coordinates | 61466..61825 (+) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | MTS72_RS19340 | Protein ID | WP_001096429.1 |
| Coordinates | 61825..62124 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTS72_RS19305 (MTS72_19305) | 56987..57301 | - | 315 | WP_000708714.1 | hypothetical protein | - |
| MTS72_RS19310 (MTS72_19310) | 58356..59114 | - | 759 | WP_001053127.1 | hypothetical protein | - |
| MTS72_RS19315 (MTS72_19315) | 59181..59564 | - | 384 | WP_000654348.1 | hypothetical protein | - |
| MTS72_RS19320 (MTS72_19320) | 59703..60401 | - | 699 | WP_000873188.1 | hypothetical protein | - |
| MTS72_RS19325 (MTS72_19325) | 60468..60650 | - | 183 | WP_000373385.1 | hypothetical protein | - |
| MTS72_RS19330 (MTS72_19330) | 60699..61265 | - | 567 | WP_000710385.1 | hypothetical protein | - |
| MTS72_RS19335 (MTS72_19335) | 61466..61825 | + | 360 | WP_000312250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| MTS72_RS19340 (MTS72_19340) | 61825..62124 | + | 300 | WP_001096429.1 | XRE family transcriptional regulator | Antitoxin |
| MTS72_RS19345 (MTS72_19345) | 62662..63198 | - | 537 | WP_000731978.1 | hypothetical protein | - |
| MTS72_RS19350 (MTS72_19350) | 63248..63802 | - | 555 | WP_000790084.1 | hypothetical protein | - |
| MTS72_RS19355 (MTS72_19355) | 63822..64040 | - | 219 | WP_001043201.1 | hypothetical protein | - |
| MTS72_RS19360 (MTS72_19360) | 64080..64709 | - | 630 | WP_000701003.1 | hypothetical protein | - |
| MTS72_RS19365 (MTS72_19365) | 64726..64905 | - | 180 | WP_000387630.1 | hypothetical protein | - |
| MTS72_RS19370 (MTS72_19370) | 64881..65453 | - | 573 | WP_000443897.1 | hypothetical protein | - |
| MTS72_RS19375 (MTS72_19375) | 65458..65715 | - | 258 | WP_000834290.1 | hypothetical protein | - |
| MTS72_RS19380 (MTS72_19380) | 65820..67100 | - | 1281 | WP_001093570.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aph(3')-VIa | - | 1..70544 | 70544 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13751.62 Da Isoelectric Point: 4.8212
>T276442 WP_000312250.1 NZ_CP121596:61466-61825 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|