Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 6553..7211 | Replicon | plasmid pIV_MAB9 |
| Accession | NZ_CP121589 | ||
| Organism | Acinetobacter baumannii strain MAB9 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | MTS46_RS19670 | Protein ID | WP_000312250.1 |
| Coordinates | 6553..6912 (+) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | MTS46_RS19675 | Protein ID | WP_001096429.1 |
| Coordinates | 6912..7211 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTS46_RS19640 (MTS46_19640) | 2074..2388 | - | 315 | WP_000708714.1 | hypothetical protein | - |
| MTS46_RS19645 (MTS46_19645) | 3443..4201 | - | 759 | WP_001053127.1 | hypothetical protein | - |
| MTS46_RS19650 (MTS46_19650) | 4268..4651 | - | 384 | WP_000654348.1 | hypothetical protein | - |
| MTS46_RS19655 (MTS46_19655) | 4790..5488 | - | 699 | WP_000873188.1 | hypothetical protein | - |
| MTS46_RS19660 (MTS46_19660) | 5555..5737 | - | 183 | WP_000373385.1 | hypothetical protein | - |
| MTS46_RS19665 (MTS46_19665) | 5786..6352 | - | 567 | WP_000710385.1 | hypothetical protein | - |
| MTS46_RS19670 (MTS46_19670) | 6553..6912 | + | 360 | WP_000312250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| MTS46_RS19675 (MTS46_19675) | 6912..7211 | + | 300 | WP_001096429.1 | XRE family transcriptional regulator | Antitoxin |
| MTS46_RS19680 (MTS46_19680) | 7749..8285 | - | 537 | WP_000731978.1 | hypothetical protein | - |
| MTS46_RS19685 (MTS46_19685) | 8335..8889 | - | 555 | WP_000790084.1 | hypothetical protein | - |
| MTS46_RS19690 (MTS46_19690) | 8909..9127 | - | 219 | WP_001043201.1 | hypothetical protein | - |
| MTS46_RS19695 (MTS46_19695) | 9167..9796 | - | 630 | WP_000701003.1 | hypothetical protein | - |
| MTS46_RS19700 (MTS46_19700) | 9813..9992 | - | 180 | WP_000387630.1 | hypothetical protein | - |
| MTS46_RS19705 (MTS46_19705) | 9968..10540 | - | 573 | WP_000443897.1 | hypothetical protein | - |
| MTS46_RS19710 (MTS46_19710) | 10545..10802 | - | 258 | WP_000834290.1 | hypothetical protein | - |
| MTS46_RS19715 (MTS46_19715) | 10907..12187 | - | 1281 | WP_001093570.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..68108 | 68108 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13751.62 Da Isoelectric Point: 4.8212
>T276439 WP_000312250.1 NZ_CP121589:6553-6912 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|