Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 58844..59502 | Replicon | plasmid pIV_RAB73 |
Accession | NZ_CP121568 | ||
Organism | Acinetobacter baumannii strain RAB73 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | MTS81_RS19305 | Protein ID | WP_000312250.1 |
Coordinates | 59143..59502 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | MTS81_RS19300 | Protein ID | WP_001096429.1 |
Coordinates | 58844..59143 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MTS81_RS19260 (MTS81_19260) | 53870..55150 | + | 1281 | WP_001093570.1 | hypothetical protein | - |
MTS81_RS19265 (MTS81_19265) | 55255..55512 | + | 258 | WP_000834290.1 | hypothetical protein | - |
MTS81_RS19270 (MTS81_19270) | 55517..56089 | + | 573 | WP_000443897.1 | hypothetical protein | - |
MTS81_RS19275 (MTS81_19275) | 56065..56244 | + | 180 | WP_000387630.1 | hypothetical protein | - |
MTS81_RS19280 (MTS81_19280) | 56261..56890 | + | 630 | WP_000701003.1 | hypothetical protein | - |
MTS81_RS19285 (MTS81_19285) | 56930..57148 | + | 219 | WP_001043201.1 | hypothetical protein | - |
MTS81_RS19290 (MTS81_19290) | 57168..57722 | + | 555 | WP_000790084.1 | hypothetical protein | - |
MTS81_RS19295 (MTS81_19295) | 57772..58308 | + | 537 | WP_000731978.1 | hypothetical protein | - |
MTS81_RS19300 (MTS81_19300) | 58844..59143 | - | 300 | WP_001096429.1 | XRE family transcriptional regulator | Antitoxin |
MTS81_RS19305 (MTS81_19305) | 59143..59502 | - | 360 | WP_000312250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MTS81_RS19310 (MTS81_19310) | 59703..60269 | + | 567 | WP_000710385.1 | hypothetical protein | - |
MTS81_RS19315 (MTS81_19315) | 60318..60500 | + | 183 | WP_000373385.1 | hypothetical protein | - |
MTS81_RS19320 (MTS81_19320) | 60567..61265 | + | 699 | WP_000873188.1 | hypothetical protein | - |
MTS81_RS19325 (MTS81_19325) | 61404..61787 | + | 384 | WP_000654348.1 | hypothetical protein | - |
MTS81_RS19330 (MTS81_19330) | 61854..62612 | + | 759 | WP_001053127.1 | hypothetical protein | - |
MTS81_RS19335 (MTS81_19335) | 63661..63975 | + | 315 | WP_000708714.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..68038 | 68038 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13751.62 Da Isoelectric Point: 4.8212
>T276422 WP_000312250.1 NZ_CP121568:c59502-59143 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|